Identifiers and Description

Gene Model Identifier

SteCoe_21807

Standard Name

None

Aliases

None

Description

Adaptin_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig21140.0.g1030Adaptin N terminal region

Tetrahymena ThermophilaTTHERM_004883501.0927656633766312e-73Adaptin N terminal region fami
ly protein; coatamer (COP) bet
a subunit
WormBaseWBGene000212929.710436457780846e-67
Saccharomyces CerevisiaeYDR238C5.301718666092324e-65Essential beta-coat protein of
the COPI coatomer; involved i
n ER-to-Golgi protein traffick
ing and maintenance of normal
ER morphology; shares 43% sequ
ence identity with mammalian b
eta-coat protein (beta-COP)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_21807(Protein)
MPEHLKACYLIIDYDVQSPPSSSEIAKLLEKGSEEEKIDAMKTLILMILSDEHFPRMIMT
VVQHAMRVDSKDMKKLLIIYWEAIEKTNPDGTIKDEMVMLCNALRNDLLSPNEFIRARTL
RLVSKMRYREMMDTLLQPALECLTHRHPYVRRNAVMCVYSIYLAFGEDILPDAVERIDNL
LSSETDLSTRRNALLFLFEASPTIAMRYLNSVLLDEDDSNSVYGTSIDILQLVVLDELKK
VCKANPLEKGKYMKSIFNLAMTSKSQSVLFECASIITQLTSMPNAIKLAISTYLKLLNDP
SSDSNMKLLLVENLVLLKDKHKKILQDQAVEILRALTTPSNDIRSKCINLVLELLSNRNV
EDIIRILKKELLSVQGKKEEISYQDMLVNALHTCAVRFPGITEQVGLVEVLMDSCLLQEV
TDTDVSSFIQQIIVDYPSLRGIILNKLYHIFAEINSATVYRTALWIFSEFAEDADKTINC
ILHSIGESPYFNKKEKTEVFEVKEESERAHKTVILPDGTYGTQILSAKDIAKPKNLTGLR
KLLTETEEVDYYLITVIAKSLTKLFFKLPEMKKNSHKHNILSILCSIIQIRTYPKKSRNS
TEYSEIPCSIDPENFEQVILCMQTITGLRSSDWVTSGIDLYKQTQEENIKQTEEISTENQ
LTQPDDLIIIKQLRGKEGISDMDFADDTSFRTLFEDSNLNDFSLKLSKVRTLTGLDDVVY
VECSLCMNHYDISAEFNIYNRSSETLKNLTLELAVDGELKLVEKPQVINIGPLQNSIMKA
TVKVASTEAGVIFGNITYDTQRGGNVKVITLNEIVIDTIEYINPSYCSDGEFRKMWQEFK
WEFPVAVTSGKKDLVEFVRKIACKTNMQVLTHENVLRCSEDFLVANLYAKSKFNEDALMN
VSVERTGNGITGNVRIRAKNSGMAKCLGQRISMITRYDN


>SteCoe_21807(CDS)
ATGCCTGAACATCTCAAAGCCTGTTATCTGATAATCGACTACGACGTTCAAAGCCCACCA
AGTAGCAGTGAAATTGCGAAGCTCCTCGAAAAAGGTTCAGAAGAGGAAAAAATCGATGCG
ATGAAAACATTAATCCTCATGATCCTATCAGACGAGCATTTTCCACGAATGATAATGACA
GTAGTCCAACATGCAATGAGAGTAGACTCTAAAGATATGAAAAAATTGCTTATAATCTAC
TGGGAAGCTATAGAAAAAACAAACCCAGATGGGACAATCAAGGATGAAATGGTCATGTTA
TGTAATGCTTTAAGAAATGACCTTTTAAGTCCAAATGAATTTATCAGAGCCAGGACTTTA
AGACTAGTCAGTAAAATGCGATATAGAGAAATGATGGACACTTTATTACAACCAGCATTA
GAATGTTTAACCCATAGACATCCTTATGTAAGAAGAAATGCTGTAATGTGTGTTTATAGT
ATCTATCTTGCATTTGGTGAAGATATACTTCCAGATGCAGTAGAACGTATAGACAATTTA
TTATCATCAGAAACTGATTTAAGTACAAGACGTAATGCTTTATTATTCCTATTTGAAGCT
TCTCCAACTATAGCTATGAGATATCTTAATAGTGTTTTATTAGATGAAGATGACTCGAAT
TCTGTATATGGGACAAGTATTGATATTCTCCAATTAGTCGTTTTAGATGAATTGAAAAAA
GTATGTAAAGCAAATCCTTTAGAAAAAGGCAAGTATATGAAATCTATATTCAATTTAGCA
ATGACTTCTAAAAGCCAAAGTGTATTATTTGAATGTGCATCGATAATAACTCAACTTACA
TCAATGCCTAATGCTATAAAACTAGCTATATCAACTTATCTAAAACTTTTAAATGACCCA
AGTTCTGATAGTAACATGAAACTTTTACTTGTTGAGAACCTTGTTTTACTTAAAGATAAA
CACAAAAAAATCCTCCAAGACCAAGCTGTAGAAATACTTAGAGCTCTTACTACACCTTCA
AATGATATAAGAAGTAAATGTATTAATTTGGTTTTAGAACTTCTGTCAAATAGAAATGTT
GAAGATATTATAAGGATATTAAAAAAAGAACTTCTTAGTGTACAAGGGAAAAAAGAAGAG
ATTTCTTATCAGGATATGTTAGTTAATGCTTTACATACTTGTGCTGTAAGATTCCCTGGG
ATAACAGAACAAGTTGGTCTTGTTGAAGTTCTAATGGACAGTTGCTTACTTCAAGAAGTT
ACTGATACTGATGTTTCATCTTTTATTCAACAGATTATTGTTGATTATCCTTCACTTAGA
GGAATTATACTTAATAAGCTTTATCATATATTTGCTGAAATCAATTCAGCTACTGTTTAT
CGTACGGCTTTGTGGATTTTTTCAGAATTCGCTGAAGATGCGGATAAGACAATCAATTGC
ATACTTCATAGTATTGGAGAAAGTCCTTATTTTAATAAAAAGGAAAAAACTGAAGTTTTT
GAAGTCAAAGAAGAGTCAGAAAGAGCCCATAAGACTGTGATTTTACCTGATGGGACTTAT
GGGACGCAGATTTTATCAGCTAAAGATATCGCTAAGCCTAAAAATTTAACAGGTCTTCGC
AAGCTTTTAACAGAAACTGAAGAAGTCGACTACTATCTTATTACCGTCATAGCCAAATCT
TTAACAAAACTGTTTTTCAAACTTCCAGAAATGAAGAAAAATTCACATAAACACAATATC
CTTTCTATACTTTGTAGCATAATCCAAATAAGAACATATCCTAAAAAGTCAAGAAATTCT
ACTGAATATAGTGAAATCCCATGTAGTATCGACCCTGAGAATTTTGAACAAGTCATTTTG
TGTATGCAAACTATAACAGGACTTAGATCTTCTGATTGGGTAACAAGTGGTATTGATTTA
TACAAGCAAACTCAAGAAGAAAACATAAAACAAACTGAAGAAATATCAACAGAAAATCAA
TTAACTCAACCTGATGATCTTATTATAATCAAACAGCTTAGAGGTAAAGAAGGGATTAGT
GATATGGATTTTGCTGATGACACTTCTTTTAGAACTTTATTTGAAGATTCTAATTTAAAC
GACTTTTCACTCAAACTTAGCAAAGTTAGAACACTTACTGGGCTTGATGATGTAGTTTAT
GTTGAATGTTCGCTTTGTATGAATCATTATGATATATCTGCAGAGTTTAATATTTACAAT
AGAAGTAGTGAAACTTTAAAAAATCTAACATTAGAACTTGCTGTTGATGGGGAATTGAAA
TTAGTAGAAAAACCTCAAGTTATCAATATTGGACCATTACAAAACTCTATAATGAAAGCT
ACAGTTAAAGTTGCAAGTACTGAAGCAGGGGTGATTTTTGGTAATATTACTTATGATACA
CAAAGAGGTGGAAATGTTAAGGTTATAACTTTAAATGAGATTGTTATTGATACTATTGAA
TATATAAATCCTTCTTATTGTTCTGATGGGGAATTTAGGAAAATGTGGCAAGAGTTTAAG
TGGGAATTTCCTGTTGCAGTGACATCTGGGAAAAAAGATTTGGTTGAGTTTGTTAGGAAA
ATAGCTTGTAAAACAAATATGCAGGTGTTAACTCATGAGAATGTACTTAGGTGTAGTGAA
GATTTTTTGGTTGCAAATTTGTATGCGAAGTCTAAGTTTAATGAAGATGCGCTGATGAAT
GTTTCGGTTGAAAGAACGGGGAATGGGATTACTGGAAATGTGAGGATTAGGGCTAAGAAC
TCAGGGATGGCTAAATGCTTGGGACAAAGGATTTCTATGATTACTAGATATGATAATTAA