Identifiers and Description

Gene Model Identifier

SteCoe_21869

Standard Name

None

Aliases

None

Description

SIR2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_008593303.975449735908647e-31Sir2-like histone deacetylase
Oxytricha TrifallaxContig11428.0.g427.984904245686979e-30Sir2 family

Saccharomyces CerevisiaeYPL015C0.0000022603294069810542Cytoplasmic NAD(+)-dependent p
rotein deacetylase; member of
the silencing information regu
lator 2 (Sir2) family of NAD(+
)-dependent protein deacetylas
es; modulates nucleolar (rDNA)
and telomeric silencing; poss
esses NAD(+)-dependent histone
deacetylase activity in vitro
; contains a nuclear export si
gnal (NES); function regulated
by its nuclear export

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_21869(Protein)
MSITKEILKARDIIKQSDFIMITAGAGMSVDSGLPDFRGPQGFWKAYPPMKKLGLTLPEA
SNPTWFYQDPAFAWGFFGHRYNLYKTSTPHAGHSILKKWVASKEYFIYTSNVDGHFAKSG
FSDDKIVECHGTIHYLQCLDTCSLDIWPMNQFVNFDPTTFRAKEPLPICKNCGRLARPNI
LMFGDSDWISNRTYDQMDRLENALNESKGKMAVIEIGAGEALPRIRVFGQRLADKKNANL
IRINPDETKDIRDSAIEIHMGALDALKILDSVMDDV


>SteCoe_21869(CDS)
ATGAGTATTACTAAAGAAATCCTTAAAGCTAGAGATATTATAAAACAAAGCGACTTTATA
ATGATCACAGCAGGTGCTGGAATGAGTGTAGACTCCGGACTTCCCGATTTCCGAGGTCCT
CAAGGTTTCTGGAAAGCATATCCCCCAATGAAGAAACTAGGGCTAACATTACCAGAGGCA
TCAAATCCAACATGGTTTTATCAAGACCCAGCTTTTGCTTGGGGTTTCTTCGGTCATCGT
TACAATTTATATAAAACAAGTACCCCTCATGCTGGACATAGTATTTTAAAAAAGTGGGTT
GCCAGTAAAGAATATTTTATATATACATCAAATGTTGATGGGCATTTTGCAAAATCTGGC
TTTTCTGATGATAAAATTGTAGAATGTCATGGGACAATCCATTATTTACAATGCTTAGAT
ACTTGTAGTCTTGATATATGGCCAATGAATCAATTTGTAAATTTTGACCCAACAACTTTT
AGGGCAAAAGAACCTTTGCCTATATGCAAAAACTGTGGTCGCTTAGCTAGACCTAACATT
TTAATGTTTGGGGATAGTGATTGGATATCTAATCGGACATATGATCAAATGGATAGGCTT
GAAAATGCATTAAATGAATCAAAAGGTAAAATGGCTGTTATTGAAATTGGAGCTGGAGAA
GCTTTACCTAGAATTAGGGTATTTGGTCAGAGATTGGCTGATAAGAAAAATGCGAATTTA
ATTAGGATTAATCCTGATGAGACTAAGGATATAAGAGATAGTGCGATTGAAATACATATG
GGAGCATTAGATGCGTTGAAGATATTAGATTCAGTAATGGATGATGTTTAG