Identifiers and Description

Gene Model Identifier

SteCoe_21951

Standard Name

None

Aliases

None

Description

vATP-synt_E domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178

Molecular Function

  • proton-transporting ATPase activity, rotational mechanism (IEA) | GO:0046961

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig16360.0.g46.305116760146989e-16ATP synthase (E/31 kDa) subuni
t

WormBaseWBGene000069170.000000000000004658886145103398
Tetrahymena ThermophilaTTHERM_001936600.0000000000006914400106940203vacuolar ATP synthase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_21951(Protein)
MISFVQEEAKDKAREIETRTEHEYNAAKSKHLFQAKEKLVAENAKKWKNLEIKRRIDRSA
AINAARMEIMKARSDCMSTLVDEARTELARRTTKNPKQXRTTKNPKQYKKILENLIVQGL
IKMLENHIKIQCRASDAHLVQEVLESSKRKYVDIMKSSTGKDYDVEIEIDSINLPPGPGE
TTHGPSCAGGVILTANHGKIRCINTLDERLKAVVEFNTPGLRKLLFS


>SteCoe_21951(CDS)
ATGATTTCCTTCGTGCAAGAAGAGGCCAAAGACAAGGCAAGAGAAATTGAGACCCGTACT
GAGCATGAATACAATGCAGCGAAATCCAAACACTTATTCCAAGCAAAGGAAAAGCTGGTT
GCTGAAAATGCAAAGAAATGGAAAAACCTTGAAATTAAGAGAAGGATTGACAGAAGTGCG
GCTATTAATGCAGCAAGAATGGAAATCATGAAAGCTAGAAGCGATTGTATGAGCACTTTG
GTTGATGAAGCACGCACTGAGCTTGCTCGTAGAACAACCAAAAACCCAAAGCAGNATAGA
ACAACCAAAAACCCAAAGCAATATAAGAAAATATTAGAAAACTTGATTGTCCAAGGCCTT
ATTAAGATGTTAGAAAATCATATAAAAATCCAGTGCAGAGCTTCTGATGCTCATTTGGTC
CAAGAAGTACTTGAATCTTCGAAAAGGAAATATGTGGATATTATGAAAAGCAGCACAGGT
AAGGATTATGATGTTGAAATAGAAATTGATTCAATTAATCTCCCACCTGGACCTGGAGAA
ACTACCCATGGACCATCTTGTGCTGGAGGAGTTATATTGACAGCTAATCATGGAAAAATC
AGATGCATAAATACCCTTGATGAAAGACTTAAAGCTGTAGTAGAATTTAACACCCCTGGG
CTTAGGAAATTACTTTTTAGCTAA