Identifiers and Description

Gene Model Identifier

SteCoe_21979

Standard Name

None

Aliases

None

Description

Tubulin domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig3513.0.g100Tubulin/FtsZ family, GTPase do
main

WormBaseWBGene000065401.5400882849875202e-51
Saccharomyces CerevisiaeYLR212C3.093350011308561e-50Gamma-tubulin; involved in nuc
leating microtubules from both
the cytoplasmic and nuclear f
aces of the spindle pole body;
protein abundance increases i
n response to DNA replication
stress

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_21979(Protein)
MPREIITLQVGQCGNQIGMEFWKQLCQEHGINHEGLLEDYATSSDDRKDVFFYQADDEHY
IPRALLIDLEPRVIHTIQTSHYSSLYNPENIFISKEGGGAGNNWASGYGQAEKVQEEILD
MIEREADGSDSLEGFVLLHSIAGGTGSGMGSYLLEKLNERFPKKLIQTYSVFPNQQQTDV
VVQPYNSLLTLKRLTLNADCVVVLDNAALNHIAVDRLKIPNPSFSQTNSLVSTVMAASTT
TLRYPGYMNNDLVGLVASLIPTPRCHFLMTGYTPLTLDRHVSSIRKTTVLDVMRRLLQTK
NIMVSTNPKDGVYMSILNIIQGEVDPTQVHKSLQRIRERKLANFISWGPASIQVALSRKS
PYIETSHKVSGLMLANHTCIHKLFEKIYTHYKKLRSRNAFLDNYKKEKLFSENLDEFDGS
VEVVEQLIEEYKAAGSNNYMNWGMEDSKMESD


>SteCoe_21979(CDS)
ATGCCTAGAGAAATTATAACTTTACAGGTTGGTCAATGTGGTAATCAAATCGGTATGGAA
TTTTGGAAACAGCTTTGTCAAGAACATGGAATCAATCATGAAGGGCTTTTAGAAGATTAT
GCAACTTCTAGTGATGATAGGAAAGATGTGTTTTTTTATCAGGCTGATGATGAGCATTAT
ATCCCAAGAGCTTTATTGATTGATTTAGAGCCAAGAGTAATTCACACAATTCAAACCTCG
CATTACTCATCATTATATAATCCTGAGAATATTTTTATAAGTAAAGAAGGTGGTGGCGCG
GGAAACAATTGGGCTTCAGGATATGGTCAAGCAGAAAAGGTTCAAGAAGAGATTCTTGAT
ATGATTGAAAGAGAAGCTGATGGAAGTGATTCATTAGAAGGTTTTGTCCTTTTACATTCT
ATAGCAGGCGGTACAGGGTCAGGAATGGGTTCATATTTATTAGAAAAACTTAATGAAAGG
TTTCCGAAAAAACTTATTCAAACTTATTCAGTGTTTCCAAATCAGCAACAAACAGATGTG
GTTGTCCAGCCATATAACAGTTTATTGACTTTAAAACGTTTGACTTTAAATGCAGATTGT
GTAGTTGTATTAGATAATGCAGCTTTAAATCATATAGCTGTAGATAGGCTTAAAATCCCA
AATCCAAGTTTTAGTCAAACTAATTCTTTAGTATCTACAGTTATGGCTGCATCAACTACT
ACTTTAAGATATCCTGGGTATATGAATAATGATTTAGTTGGACTTGTTGCATCTTTAATA
CCAACACCAAGATGTCATTTTCTTATGACTGGATATACTCCTTTAACTTTAGATAGACAT
GTTAGTTCTATTAGAAAAACTACTGTTCTTGATGTTATGAGAAGACTTTTACAAACAAAA
AATATCATGGTCTCAACAAATCCTAAAGATGGAGTTTATATGAGTATTCTTAATATTATA
CAAGGAGAAGTTGATCCTACACAGGTTCATAAATCGTTACAGAGAATTAGAGAAAGAAAA
TTAGCTAATTTTATATCTTGGGGACCGGCTTCAATACAAGTTGCCTTATCAAGAAAATCT
CCATATATTGAAACTTCGCATAAGGTCTCTGGGCTTATGCTTGCTAATCATACATGTATA
CATAAATTGTTTGAAAAAATATACACGCATTATAAGAAACTTAGATCAAGAAATGCTTTT
TTGGATAATTATAAAAAGGAAAAACTTTTTTCTGAGAATTTAGATGAGTTTGATGGGTCG
GTTGAAGTTGTTGAACAATTGATTGAAGAATATAAGGCTGCGGGAAGTAATAATTATATG
AACTGGGGAATGGAAGACTCAAAGATGGAAAGTGATTAA