Identifiers and Description

Gene Model Identifier

SteCoe_2198

Standard Name

None

Aliases

None

Description

Histone domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002831803.532628572200807e-24Histone H2B; one of the four h
istones (H2A, H2B, H3 and H4)
that comprise the protein core
of the eukaryotic nucleosome;
differs from Htb1p by three a
mino acids
Oxytricha TrifallaxContig9113.0.g473.532628572200807e-24Core histone H2A/H2B/H3/H4

Saccharomyces CerevisiaeYDR224C7.095474162284704e-23Histone H2B; core histone prot
ein required for chromatin ass
embly and chromosome function;
nearly identical to HTB2; Rad
6p-Bre1p-Lge1p mediated ubiqui
tination regulates reassembly
after DNA replication, transcr
iptional activation, meiotic D
SB formation and H3 methylatio
n
WormBaseWBGene000018781.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_2198(Protein)
MVKGTKKAEKKAGAPVKVATDKKKSKKRSETFSLYIYRVLKQVHPDIGISKKSMSIMNSF
INDIFEKSCMESSKLVRYGKKRTLSSREVQTSVRLILPGELAKHAVSEGTKAVTKFAS


>SteCoe_2198(CDS)
ATGGTAAAAGGAACAAAGAAAGCTGAAAAGAAAGCCGGAGCTCCAGTCAAAGTTGCCACT
GATAAGAAGAAATCTAAGAAAAGATCAGAGACTTTTTCATTATACATTTACAGAGTTTTG
AAACAAGTCCATCCAGATATTGGTATTTCTAAGAAATCAATGAGCATTATGAACTCTTTC
ATCAACGATATTTTTGAAAAGAGTTGCATGGAATCAAGTAAACTTGTAAGATATGGCAAG
AAAAGAACACTTTCAAGTAGAGAAGTCCAGACTAGCGTTAGACTTATTCTTCCTGGAGAA
CTTGCCAAACATGCTGTCAGTGAAGGAACTAAAGCTGTTACCAAGTTTGCAAGTTAA