Identifiers and Description

Gene Model Identifier

SteCoe_22182

Standard Name

None

Aliases

None

Description

RPN7 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_001912402.7487850079102147e-43Probable 26S proteasome non-AT
Pase regulatory subunit 6, put
ative
Oxytricha TrifallaxContig3169.0.g505.5210822770285325e-4226S proteasome subunit RPN7

WormBaseWBGene000044635.380186160021138e-32
Saccharomyces CerevisiaeYPR108W1.0806392777072785e-30Essential non-ATPase regulator
y subunit of the 26S proteasom
e; similar to another S. cerev
isiae regulatory subunit, Rpn5
p, as well as to mammalian pro
teasome subunits

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22182(Protein)
MSLSRTASVQDWSAKEESMRKAEESSTETPEALTKLYLKLKEAEENFSDLEIRDALIEIG
DYFIQQGNCERSLNNYNSAYSKAATTDAKLDITLKIMLVAFKTKDRILLKKQVEQANTLF
DEGGDWEKKNRFKAYEAVYFMMMRNFKQAALNFLDIVATFTSTELISFTVFIQYTIITSI
VSLDRATISKKVVNSPEVLSVINEIPVINQLLTGLYKCNYKSFFIALSSVIKIVEDDEFI
SQHSRYWAREMRVVAYSQFLESYRSVTLASMAQNFGVSVNFVDKELCEFIYLGRLACKID
KVNGVIESCRPDTRSSIFNNIVKNGDFLLNRLQKLARVMDV


>SteCoe_22182(CDS)
ATGAGTTTGTCCAGAACAGCATCAGTTCAAGACTGGTCAGCAAAAGAAGAATCCATGCGT
AAAGCTGAAGAATCTTCTACTGAAACCCCAGAAGCTCTAACCAAGCTTTACCTCAAACTC
AAAGAAGCAGAGGAAAATTTTTCAGACCTCGAAATCAGAGATGCTCTTATTGAAATCGGT
GATTATTTCATTCAACAAGGTAACTGTGAAAGAAGTTTAAACAACTACAACTCAGCATAT
AGTAAAGCGGCAACAACAGATGCTAAACTGGATATAACATTAAAAATTATGCTAGTGGCA
TTTAAAACCAAAGACCGCATTCTTCTTAAAAAGCAAGTTGAACAAGCTAATACTCTTTTT
GATGAAGGAGGTGATTGGGAAAAGAAAAATAGATTCAAAGCTTATGAGGCTGTTTATTTT
ATGATGATGAGGAACTTCAAACAAGCTGCATTAAATTTCCTTGATATTGTAGCCACATTT
ACTTCAACTGAACTTATATCATTTACAGTGTTTATTCAATATACAATTATTACTAGCATT
GTATCTTTAGACAGAGCTACAATTAGTAAAAAAGTTGTAAATTCGCCTGAGGTTCTTTCA
GTGATCAATGAAATCCCTGTAATAAATCAGCTTCTTACTGGGCTTTATAAATGCAATTAC
AAATCATTTTTTATAGCTTTGAGTAGTGTGATTAAGATTGTTGAAGATGATGAGTTTATC
AGTCAGCATTCTCGCTATTGGGCTAGAGAAATGAGAGTTGTCGCTTATTCACAGTTTTTA
GAAAGCTATAGGAGTGTAACTCTTGCTAGTATGGCTCAGAACTTTGGGGTTTCTGTGAAT
TTTGTGGATAAGGAACTATGTGAGTTTATCTACCTAGGAAGACTAGCTTGCAAAATCGAT
AAAGTCAATGGAGTTATTGAGTCTTGCCGCCCAGATACCCGCAGTTCAATATTCAACAAT
ATTGTTAAGAATGGAGATTTTCTCTTGAACAGGTTACAGAAATTAGCTAGAGTTATGGAC
GTTTAG