Identifiers and Description

Gene Model Identifier

SteCoe_22183

Standard Name

None

Aliases

None

Description

Ras domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig19016.0.g576.639677199580735e-36Ras family

Tetrahymena ThermophilaTTHERM_004972709.854154686111257e-34hypothetical protein
WormBaseWBGene000042740.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22183(Protein)
MEAEDYHFRFKIVLIGDNGVGKTTLLDALTQNYGRVLENETVEEMHFKSVTYVDETTFYR
LNYWDLPGSERYLPVTSRYCAGATAAMFVFDITKRASFERIEKWIKECEKVEILSKVLLG
NKIDLAGRKDSTPVTKTEAMSLARKYGMEYFEISALDENSLRSMFEHVFNSIVANIPNPP
DPGMLLGKSISLGRRITNNPKFKTALFDTDSRYD


>SteCoe_22183(CDS)
ATGGAAGCAGAAGACTACCACTTTCGATTCAAAATTGTGCTTATTGGAGACAACGGAGTT
GGTAAAACTACATTACTCGATGCTTTAACTCAGAACTATGGCCGAGTATTAGAAAATGAG
ACAGTAGAAGAAATGCATTTCAAATCGGTAACATATGTTGATGAGACTACTTTTTATAGA
CTCAACTATTGGGATTTACCAGGTAGTGAAAGATACTTACCAGTTACAAGCAGATATTGT
GCAGGGGCAACAGCGGCGATGTTTGTATTTGACATTACTAAAAGAGCATCATTTGAAAGG
ATTGAAAAATGGATTAAAGAGTGTGAAAAAGTAGAAATTCTATCAAAAGTGTTGCTTGGG
AATAAAATTGACCTTGCTGGAAGAAAGGATTCAACACCTGTGACGAAAACTGAAGCGATG
AGTCTTGCTAGGAAATATGGAATGGAATATTTTGAGATAAGTGCTTTAGATGAAAATAGC
CTTAGAAGTATGTTTGAACATGTGTTTAATAGTATTGTTGCTAATATACCCAACCCTCCT
GATCCTGGTATGCTGTTAGGGAAAAGTATTTCATTAGGAAGGAGGATTACTAATAATCCT
AAGTTCAAGACTGCACTTTTTGACACGGATTCTAGGTATGATTAG