Identifiers and Description

Gene Model Identifier

SteCoe_2227

Standard Name

None

Aliases

None

Description

Mnd1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003822900.000000000000004658886145103398In budding yeast, the Mnd1 pro
tein forms a complex with Hop2
to promote homologous chromos
ome pairing and meiotic DSB re
pair. Mnd1 requires Hop2 to lo
calize to chromosomes. There e
xists an ubiquitously expresse
d paralog, MNDP1.
Oxytricha TrifallaxContig15105.0.g320.000000000000004658886145103398Mnd1 family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_2227(Protein)
MGKKGVTFDEKRERMLKIFYDKKEVFNLKELETLGGKAGVISMSVKEVVQSLLDDNMVEQ
DKIGAGNFMWALPSKGRQIRMKKLDELKNSIQEIKTQKKTLTQQINNQLKDKPESSERLE
KMQELRSLISQIQEGQKRKEVLKSCSKGFYDECCLKYTGLRDSINQITDNIFMAKSFLLS
RNPGLSSSEINKHFNIPEDLDNI


>SteCoe_2227(CDS)
ATGGGGAAAAAAGGTGTGACTTTTGATGAGAAAAGAGAAAGAATGTTGAAGATTTTTTAT
GATAAAAAAGAAGTGTTTAATCTTAAAGAACTTGAAACCCTTGGAGGAAAAGCTGGAGTT
ATATCTATGTCAGTAAAAGAAGTAGTTCAAAGTTTACTAGATGACAATATGGTAGAACAA
GATAAGATCGGAGCAGGGAATTTCATGTGGGCCCTTCCTTCTAAAGGTCGCCAAATACGA
ATGAAGAAATTAGATGAGCTTAAAAATTCTATACAAGAAATAAAAACCCAGAAAAAAACT
TTAACTCAGCAAATCAACAATCAACTTAAAGATAAACCAGAATCTTCAGAAAGATTAGAA
AAAATGCAGGAACTGAGGAGTTTAATAAGCCAAATACAAGAAGGACAAAAAAGGAAGGAA
GTACTTAAATCATGCTCGAAGGGATTTTATGATGAATGCTGTTTGAAATATACTGGGCTA
AGAGACTCAATAAATCAAATCACTGATAATATTTTTATGGCGAAGTCTTTTCTTCTTAGC
CGCAATCCTGGACTATCTAGTAGTGAAATTAACAAGCATTTTAATATACCGGAAGATTTA
GACAATATATAA