Identifiers and Description

Gene Model Identifier

SteCoe_22285

Standard Name

None

Aliases

None

Description

Glyoxalase domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig5080.0.g130Glyoxalase/Bleomycin resistanc
e protein/Dioxygenase superfam
ily

Tetrahymena ThermophilaTTHERM_006782606.542840619051457e-69Homolog of vertebrate liver F-
antigen; constituent of the in
tracellular membrane network;
associated with membranes of t
he Golgi apparatus and transpo
rt vesicles
WormBaseWBGene000019937.175095973164411e-66

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22285(Protein)
MTYYEKQAERPAVGVFYSFHHIRFYVSNAKQAASFYIARFGFNPVAYEGLETGNQNYCTQ
VVSQNKVILAFTSSLRPEENEVSRHVMKHSDGVRDIAFLVDDARGIYEKAVSRGAKSVAE
PKEITDEFGTMVISSVQTYGDTIHTFVQNVNYTGLFLPGYKPNQKKDPINETLPPVNLEH
VDHAVGNQPDGDMTPTAEWYEKHLDFHRYWSVDENKIYTEYSALRSIVVADWDEAIKMPI
NEPAPGLRKSQIQEYVEFYGGAGVQHIAVLTNDIVYTIAQMKARGVEFLDVPHKYYENLR
KRLESSPTHIQEDLDILERLSILVDFDDNGYLLQIFTRPVEDRPTLFWEVIQRRNHNGFG
IGNFKALFESLEQEQAKRGNL


>SteCoe_22285(CDS)
ATGACTTACTACGAGAAACAAGCTGAGCGTCCAGCAGTTGGTGTGTTTTACAGCTTCCAC
CATATACGTTTTTATGTGTCTAATGCTAAACAAGCAGCATCTTTTTACATTGCTAGGTTT
GGTTTCAACCCTGTAGCTTATGAAGGCCTTGAGACAGGTAACCAAAACTATTGTACTCAA
GTAGTAAGTCAAAACAAGGTCATTTTGGCCTTTACTTCTAGCTTAAGACCTGAAGAAAAT
GAAGTTTCAAGACATGTCATGAAGCATAGTGATGGGGTTAGAGATATAGCTTTTCTTGTT
GATGACGCAAGAGGGATATATGAAAAAGCAGTCTCTCGTGGGGCAAAATCAGTAGCTGAA
CCTAAAGAAATCACTGATGAGTTTGGGACAATGGTCATATCTTCAGTGCAAACTTATGGT
GATACAATCCACACATTTGTTCAAAATGTTAATTATACAGGACTATTCCTTCCAGGATAT
AAGCCAAATCAGAAAAAAGACCCAATTAATGAAACTCTTCCTCCAGTTAATTTGGAACAT
GTGGATCATGCTGTTGGTAATCAACCTGATGGAGATATGACTCCAACTGCTGAATGGTAT
GAGAAACATTTGGATTTTCATAGATATTGGTCTGTTGATGAAAATAAAATATACACAGAG
TACTCAGCGTTAAGGTCAATTGTTGTTGCTGATTGGGATGAGGCAATTAAAATGCCTATT
AATGAGCCTGCACCTGGTTTACGCAAGAGCCAAATTCAAGAATATGTTGAATTTTATGGA
GGAGCTGGAGTCCAACATATCGCAGTTTTGACTAATGATATTGTATACACCATTGCTCAA
ATGAAAGCTCGTGGGGTTGAATTCCTTGATGTTCCTCACAAGTACTATGAAAATCTTAGA
AAACGCCTTGAGTCAAGCCCTACTCATATTCAAGAAGATCTTGATATCCTTGAAAGACTT
AGTATCCTTGTTGACTTTGATGATAATGGATACTTGCTACAAATTTTCACTAGACCTGTT
GAAGATCGACCAACACTGTTCTGGGAAGTCATCCAAAGACGTAATCATAACGGTTTTGGC
ATTGGGAACTTCAAAGCATTATTTGAATCATTAGAACAAGAACAAGCTAAAAGAGGAAAT
TTATAG