Identifiers and Description

Gene Model Identifier

SteCoe_22343

Standard Name

None

Aliases

None

Description

PMSR domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • peptide-methionine (S)-S-oxide reductase activity (IEA) | GO:0008113

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_002190500.000000000000001713908431542013Methionine-S-sulfoxide reducta
se
Saccharomyces CerevisiaeYER042W0.0000000000002543665647376923Methionine-S-sulfoxide reducta
se; involved in the response t
o oxidative stress; protects i
ron-sulfur clusters from oxida
tive inactivation along with M
XR2; involved in the regulatio
n of lifespan; reduced activit
y of human homolog implicated
in Alzheimer disease

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22343(Protein)
MHKVFKTSLYPPFPDGSMMVQFGMGCFWGAERMFWNLPGVINTHVGYSGGRLANPTYRQV
CYGNTEHAEVVRVVYDPNRIHFNDLLKVFWEGHDPTQGDCQGNDEGTQYRSAIYAYSQDQ
MACAEHSKCVYQEALRKRGFGQITTEIRMAPEFYYSEDDHQQYLHEHPNGYCGHGHTGVH
LDLTKL


>SteCoe_22343(CDS)
ATGCATAAAGTGTTTAAAACATCCTTATATCCACCATTTCCTGATGGCTCAATGATGGTG
CAGTTCGGCATGGGGTGCTTCTGGGGTGCTGAGCGAATGTTTTGGAATTTACCTGGGGTA
ATAAATACTCATGTCGGATACTCTGGAGGACGTCTAGCTAATCCAACATATCGGCAAGTG
TGCTATGGGAACACTGAACATGCTGAAGTAGTCAGAGTTGTATATGATCCAAATAGAATA
CATTTCAATGATCTATTAAAGGTATTTTGGGAAGGACATGACCCAACTCAAGGTGACTGT
CAAGGTAATGATGAAGGAACCCAATATAGGTCAGCTATTTATGCATACAGCCAAGATCAA
ATGGCTTGCGCTGAGCATTCAAAATGTGTATATCAAGAGGCACTTAGGAAAAGGGGCTTT
GGACAGATTACTACAGAAATCAGAATGGCCCCTGAATTTTATTATTCAGAAGATGACCAT
CAGCAATATTTACATGAACACCCTAATGGATATTGTGGACATGGACATACAGGAGTTCAT
TTAGATTTGACTAAGTTATAG