Identifiers and Description

Gene Model Identifier

SteCoe_22357

Standard Name

None

Aliases

None

Description

RNA_pol_L domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig8173.0.g804.906094730649281e-35RNA polymerase Rpb3/RpoA inser
t domain

Tetrahymena ThermophilaTTHERM_001938493.975449735908647e-31DNA-directed rna polymerase II
subunit

Saccharomyces CerevisiaeYIL021W1.4251640827409352e-21RNA polymerase II third larges
t subunit B44; part of central
core; similar to prokaryotic
alpha subunit
WormBaseWBGene000079711.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22357(Protein)
MADTFRNRTPGIEIQKLSKEKMKFTLSGVDSSIANSLRRTMIAEVPTMAIDLVQIQINTS
SLHDEFIAHRLGLIPLVSENIDEYEFPRNCKCSGHCQCCAVQFRLKVKNSEGGVLDVTSM
DLRRVSQSANEVRPADIDGPILLLKLKKNQEIDITCNARKGIGKEHAKWSPVATCSFKYT
PEIILNTPKIETLMDLKDKQDFVNSCPAKVFNLNEDNIEIVKPNKCMFCDECVRKGESMI
TKSSIAILNSLENIVRINQIKDKFVFKVESSGALKPESILMKAFTLLCTKLEDIKGAIPK


>SteCoe_22357(CDS)
ATGGCTGATACCTTTCGCAATCGCACTCCAGGCATTGAAATCCAGAAGCTCAGCAAGGAA
AAAATGAAATTCACGCTAAGCGGGGTTGATTCAAGTATCGCCAATTCACTTAGAAGGACA
ATGATAGCTGAAGTTCCAACAATGGCTATAGATTTAGTTCAGATACAAATAAACACAAGT
TCTTTACATGATGAGTTTATTGCACATAGACTTGGACTTATCCCTTTAGTCAGTGAGAAT
ATTGATGAATACGAGTTCCCAAGAAATTGTAAATGCTCAGGTCATTGTCAATGTTGTGCT
GTACAGTTCAGATTGAAAGTGAAAAATTCAGAAGGTGGGGTTTTAGATGTTACATCAATG
GATCTTAGAAGAGTATCACAATCTGCTAATGAAGTCCGTCCTGCTGATATTGATGGACCA
ATATTGTTACTAAAACTTAAAAAAAATCAGGAAATCGATATTACATGTAATGCACGTAAA
GGAATAGGTAAAGAACATGCGAAATGGTCACCAGTAGCTACTTGTTCGTTTAAATACACT
CCTGAGATTATCTTAAATACTCCAAAAATCGAAACATTGATGGACCTTAAAGATAAACAA
GATTTCGTCAACTCCTGCCCGGCAAAAGTTTTTAATCTTAATGAAGACAATATAGAAATT
GTTAAACCTAACAAATGCATGTTTTGTGATGAATGTGTGAGAAAAGGAGAGTCTATGATT
ACTAAGTCGTCAATTGCTATTTTGAACTCTTTAGAAAATATTGTCCGTATTAATCAAATT
AAAGACAAATTTGTGTTTAAGGTTGAAAGCTCTGGGGCTTTGAAACCAGAAAGCATTTTA
ATGAAAGCATTTACACTATTATGTACAAAACTTGAAGATATTAAAGGGGCTATTCCTAAG
TAG