Identifiers and Description

Gene Model Identifier

SteCoe_22519

Standard Name

None

Aliases

None

Description

zf-RING_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006722906.305116760146989e-16Glutathione S-transferase, N-t
erminal domain containing prot
ein
Oxytricha TrifallaxContig1247.1.g70.00000000000009357622968840175Ring finger domain

WormBaseWBGene000047680.000000000005109089028063325

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22519(Protein)
MLGSNLYLALSIFSAGFAVLNTYLNQEEFYATIVYIAKSKAILLILFNFLIAISIVLFKL
ITHLFFSTLKEAEVQNMESQAMHHGFNLVIVLYMLHLDFDWHIAFHIAGNIAVYALHTLG
SKRVEYLFTENYPNLDYLRAFLFHIFLIVADINLMALESSDSYESLYILLKYEYILMACF
AAKSLCVFLLQMFEKSCRHGGWENKSAILSAVEFLYNLSTLTVIVVEFMILSKRSALGIY
FIDKSMRAVMNMWKYLSGYLESRKLLSKVNHFPDATVEEIHKANDKCIFCLDNLTAAKKI
NCGHLFHYKCLRSYFENSSSPKCPTCRADIDEKVINHHVRHETISQNVASSFLLQDLPNH
VASLGNPLDIGATAWGLPKAVVGHKISRHNEKMRHAVENMNEFIVRFYRHPPDMMELPQE
EGGRDEEYKKIKENFLKMLETKNQRNS


>SteCoe_22519(CDS)
ATGTTAGGGAGCAATCTCTACTTAGCTTTAAGCATTTTCTCAGCGGGTTTCGCTGTACTA
AACACTTATCTGAATCAAGAAGAATTCTATGCAACCATAGTCTACATAGCTAAATCAAAA
GCAATCCTCTTAATCTTATTCAATTTTCTGATAGCCATAAGCATTGTCTTATTCAAACTT
ATAACCCACCTATTTTTCTCAACACTCAAAGAAGCTGAAGTTCAGAACATGGAAAGTCAA
GCAATGCATCATGGGTTCAATTTAGTTATCGTCTTATACATGTTGCATTTAGATTTTGAT
TGGCATATTGCTTTTCATATAGCCGGAAACATAGCAGTCTATGCTTTACACACTCTAGGT
AGCAAACGTGTAGAATATCTTTTTACTGAAAATTATCCTAATCTTGACTATTTACGAGCT
TTTTTGTTCCATATTTTTCTTATTGTTGCTGATATCAACCTTATGGCTTTAGAAAGTAGT
GATTCATATGAGTCTTTATATATACTTCTCAAATATGAGTATATTCTTATGGCTTGTTTT
GCTGCTAAATCTTTATGTGTTTTTTTACTTCAGATGTTTGAGAAATCATGCAGGCATGGA
GGATGGGAAAACAAATCTGCAATTCTTAGTGCTGTTGAGTTTCTATATAATTTAAGCACT
TTGACTGTTATTGTTGTTGAGTTCATGATTTTATCTAAAAGAAGTGCTTTAGGGATTTAT
TTTATAGATAAAAGCATGAGAGCTGTAATGAACATGTGGAAGTACCTTTCTGGATATCTA
GAATCAAGAAAACTCCTATCAAAAGTTAACCATTTCCCTGATGCGACTGTTGAGGAAATC
CATAAAGCTAATGATAAATGCATATTTTGTTTAGACAATCTTACAGCCGCTAAGAAAATA
AATTGTGGGCATTTGTTTCATTATAAATGCTTAAGAAGTTACTTTGAAAACTCTAGTAGT
CCTAAATGCCCAACATGTAGAGCTGATATTGATGAGAAAGTTATTAATCATCATGTAAGA
CATGAAACAATATCACAAAATGTAGCTAGTTCATTTCTTTTACAAGATCTTCCGAATCAT
GTTGCTTCATTAGGCAATCCTCTTGATATTGGGGCTACTGCTTGGGGATTACCTAAAGCG
GTTGTTGGACATAAGATATCAAGACATAATGAAAAAATGCGTCATGCGGTTGAGAATATG
AATGAATTTATTGTTAGATTTTATAGACACCCACCAGATATGATGGAATTGCCACAGGAA
GAAGGTGGTAGGGATGAGGAATATAAGAAAATCAAGGAAAATTTCCTCAAGATGCTTGAG
ACGAAAAACCAGAGGAATAGTTAA