Identifiers and Description

Gene Model Identifier

SteCoe_22558

Standard Name

None

Aliases

None

Description

PCI domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig16126.0.g914.4737793061811207e-38PCI domain

Tetrahymena ThermophilaTTHERM_004460902.6786369618080778e-33PCI domain containing protein
WormBaseWBGene000044601.185064864233981e-27
Saccharomyces CerevisiaeYER021W3.532628572200807e-24Essential non-ATPase regulator
y subunit of the 26S proteasom
e lid; similar to the p58 subu
nit of the human 26S proteasom
e; temperature-sensitive allel
es cause metaphase arrest, sug
gesting a role for the proteas
ome in cell cycle control

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22558(Protein)
MADLPASLIKALDSLEKAAESKDSKICALSLRLLHGFRSKINLSTLASLFKICFNKEVQW
GENQTVYTVQYKSAEVALYLSILSVMLLIKENRLREAEEITKFELQKTHSRNSQPLIAKL
YYYLGYIYELKADLDVKEFLQYYRTSCLKHDTFSQAVLINVILRFYLLTNKVRLAKEFSE
KTGFPDTSGYPEIARNQFYLGKIKALTLNYTESHGHLVQAARKAPENGAKGFKLAVEKLR
ILIELLMGTIPSRKSLLAMKGVIPYVDLIRAVRMGELDKFAEVLDNNKTIYIEDMNYSLV
TRLRHIVIKSGLKRINLAYSAISIQDVAYKLGLKPQDTEFIIAKAIRDGVIEAFIDHESK
ELKSKTIEDVYTTNDPQTFLQKRIDFCIGLRNDTVKAMQFPQNKNNAEVKENNEDIDFDL
LSDDDDF


>SteCoe_22558(CDS)
ATGGCTGACCTCCCTGCATCGCTAATCAAGGCACTTGATAGTCTCGAAAAAGCTGCAGAA
AGCAAAGACAGCAAAATCTGCGCACTTTCCTTACGGCTTCTCCATGGATTTCGCAGTAAA
ATAAATTTGTCCACATTAGCAAGCCTTTTCAAAATCTGCTTTAACAAAGAAGTTCAATGG
GGAGAAAATCAAACAGTATATACAGTGCAGTATAAATCTGCTGAGGTTGCATTGTATTTA
TCTATATTAAGTGTAATGCTGTTGATAAAAGAAAATAGATTGCGGGAAGCTGAAGAGATC
ACTAAATTTGAACTTCAAAAGACCCATAGTAGAAACTCTCAACCATTGATAGCAAAGTTA
TACTATTATCTAGGTTATATCTATGAATTAAAAGCTGATTTAGATGTCAAAGAGTTTTTA
CAATATTATAGAACAAGTTGTTTGAAACATGATACTTTTTCCCAAGCAGTGCTGATAAAT
GTGATTTTAAGATTTTACTTGCTCACCAACAAGGTAAGACTAGCCAAAGAGTTTTCTGAG
AAGACTGGCTTTCCTGATACTTCTGGGTACCCTGAAATAGCAAGGAATCAGTTTTATCTA
GGAAAAATAAAAGCTCTGACTTTGAATTATACTGAATCTCATGGCCACTTGGTTCAAGCT
GCTAGAAAAGCCCCAGAAAATGGAGCGAAAGGTTTCAAACTAGCAGTTGAAAAACTTAGA
ATCTTGATCGAGCTTCTTATGGGAACAATTCCATCTCGTAAAAGCCTCCTTGCTATGAAA
GGAGTTATACCTTATGTTGATCTTATTCGTGCAGTAAGAATGGGTGAACTTGATAAGTTT
GCAGAAGTTCTCGATAATAACAAAACAATTTATATAGAAGATATGAATTATTCTTTAGTT
ACTCGACTTAGACATATTGTTATTAAATCAGGACTTAAAAGAATCAATCTTGCTTATTCA
GCTATTTCTATACAGGATGTTGCATATAAACTTGGCCTTAAACCACAAGATACTGAGTTT
ATTATTGCTAAAGCTATTCGTGATGGAGTTATAGAAGCTTTCATTGACCATGAATCTAAA
GAGCTTAAATCAAAGACTATTGAAGATGTTTATACCACGAATGACCCACAAACATTTTTA
CAGAAGAGAATCGATTTTTGTATTGGGCTAAGGAATGATACTGTTAAAGCTATGCAATTC
CCTCAGAATAAAAACAACGCAGAAGTTAAGGAAAACAATGAAGATATTGACTTTGATTTG
CTTAGTGATGATGATGATTTTTAG