Identifiers and Description

Gene Model Identifier

SteCoe_2266

Standard Name

None

Aliases

None

Description

PK domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18083.0.g1140Pyruvate kinase, barrel domain


Tetrahymena ThermophilaTTHERM_001186001.3485799642996046e-77pyruvate kinase; converts phos
phoenolpyruvate to pyruvate du
ring glycolysis
WormBaseWBGene000140019.462629465836378e-57
Saccharomyces CerevisiaeYAL038W1.5400882849875202e-51Pyruvate kinase; functions as
a homotetramer in glycolysis t
o convert phosphoenolpyruvate
to pyruvate, the input for aer
obic (TCA cycle) or anaerobic
(glucose fermentation) respira
tion; regulated via allosteric
activation by fructose bispho
sphate; CDC19 has a paralog, P
YK2, that arose from the whole
genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_2266(Protein)
MGPSCLKVETIVKMLDLGMNIARLNFSHGDHASHAEALRVIREANKQRPDHPCAIMLDTK
GPEIRTGLLVNHANVNLIADQELIITTDYTFLGNSGTISCSYATLPTTVKVGGIILMADG
NIQCQVKEISDTWVKVIVKNSAVLGEKKNMCLPGCYVNLPTVTEKDEDDLENFALKYNVD
FIAASFIRKASDVEIIRDILGSRGAHIKIISKIENGEGLENFEEIVKVTDGVMVARGDLG
MEIPAEKVFLAQKMMIQKCKMYGKPVITATQMLESMIDNPRPTRAEASDVANAVLDGSDS
VMLSGETANGKFPLNALEIMTRICCEAERCIDYTQEFYRLRDSIPWELSTTEAVAAGAVQ
TALELKAKLIIVITDTGLTPLQVAKFLPPMPILCVSMNQSTINQTTVIRGGLALKVPSYE
GTENLLMYSIEVAKNRGLVKKDDFCIALHGKAETDQNKANIMKILVVDESD


>SteCoe_2266(CDS)
ATGGGCCCGAGTTGCTTAAAAGTTGAAACCATCGTCAAAATGTTAGATCTTGGGATGAAT
ATCGCAAGGTTGAATTTTTCTCATGGTGACCATGCATCACATGCTGAAGCACTCAGGGTT
ATACGTGAAGCTAACAAACAAAGACCAGATCATCCATGTGCAATAATGCTTGACACTAAA
GGTCCCGAAATCAGAACTGGCTTATTAGTAAACCATGCAAATGTTAACCTTATAGCAGAT
CAAGAGCTTATAATAACAACAGATTATACTTTTCTTGGTAACTCAGGGACTATATCTTGT
AGTTATGCAACTTTACCGACAACAGTAAAAGTTGGTGGGATAATATTAATGGCAGATGGA
AACATACAATGTCAAGTTAAAGAAATAAGTGATACTTGGGTTAAAGTTATAGTAAAAAAC
TCAGCTGTTTTAGGTGAGAAAAAAAACATGTGTTTACCTGGTTGTTATGTGAATTTGCCA
ACAGTTACTGAAAAAGATGAGGATGATTTAGAAAATTTTGCTTTAAAATACAATGTTGAT
TTTATAGCAGCGAGTTTTATTCGTAAAGCTAGTGATGTTGAGATTATCCGTGATATCTTA
GGATCAAGAGGGGCGCATATAAAAATTATTAGTAAAATTGAGAATGGTGAAGGACTAGAG
AATTTTGAAGAAATAGTCAAAGTTACTGATGGAGTAATGGTCGCTAGAGGGGATTTAGGT
ATGGAAATCCCAGCTGAGAAAGTGTTTTTAGCTCAAAAAATGATGATACAAAAATGCAAA
ATGTATGGAAAACCTGTAATTACGGCTACACAAATGCTTGAAAGTATGATAGATAACCCA
AGACCTACAAGAGCTGAAGCTTCTGATGTAGCAAATGCAGTTCTTGATGGTTCTGATTCA
GTTATGTTATCTGGAGAAACTGCTAATGGGAAATTCCCATTAAATGCTTTGGAGATTATG
ACAAGAATATGTTGTGAAGCGGAAAGGTGTATTGATTATACTCAAGAATTTTATAGATTA
AGAGATTCAATACCTTGGGAATTATCAACAACTGAAGCTGTGGCTGCAGGTGCTGTACAA
ACTGCTCTTGAGCTTAAAGCTAAATTGATTATTGTTATTACTGATACTGGGTTAACACCT
TTACAAGTTGCTAAGTTTTTACCACCAATGCCGATTTTATGTGTTTCAATGAACCAATCG
ACAATTAATCAAACTACTGTTATTAGAGGAGGCCTTGCGCTTAAAGTTCCATCTTATGAA
GGGACTGAGAATTTGCTTATGTATTCGATTGAGGTAGCTAAGAATAGAGGGCTTGTGAAA
AAAGATGATTTTTGTATTGCTCTGCATGGGAAAGCGGAAACTGATCAGAATAAGGCGAAT
ATTATGAAAATATTGGTCGTGGATGAATCGGATTGA