Identifiers and Description

Gene Model Identifier

SteCoe_22675

Standard Name

None

Aliases

None

Description

RNA_pol_Rpb2_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig1141.1.g10RNA polymerase Rpb2, domain 6

WormBaseWBGene000161400

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22675(Protein)
MEDEDLSQEDAWVVISEYFKENGLVSQQLSSFNYFILHTIQEIIEDSAEITIIPERQYRP
GERLQHELKYVISFKQATLGARPVLKEHTGGSNLIFPNEARLRNLTYASNLLVDVQKQAI
VNFGDGKGENPEEEEEQKGVFIGRIPIMVRSNYCALHKKTEKERITHKECVFDQGGYFII
NGKEKVLVAQEKMANNFVYVFHKNQPSKHSWIAEIRSQNESTNKVPSAFSIKLMTKQGSK
SSHEQVIRANLPYVKSDIPVVVLFRAMGFVSDRDIISHICYDSSDVRMMELLRPSLEEAY
DIPSQEVALDFIGRRGNSVGAQKEQRIIYARNLLQKEMVPHVSVSSEYETKKAFFVGYMV
NRLCNAALGRNPEDDRDHYGKKRLDLAGSLLAGLFRQLFRRFTKTAQEVMKKQVDSQHDI
NLVSAVKEHIITHGLRYALATGNWGVDKSGAVAKTGVSQVLSRLTFSSSLSHLRRLNTPL
QKQGKLTKPRQLHNTHWGMICPAETPEGQACGLVKNLTLMAHISVSCNSSQLQRMLEELN
TENLVELSVRNIHDRTKVFFNGSWIGIHGDAEYLIKTLVSLRRQGLIPKQVSIVRDIPNK
EIRLYSDSGRVQRPLFIVEDCRLKMTKEHIEKFKLPREHPSHLSFEKCTEMGLIEYLDTE
EEETSMISMMMKDLQDSKNKYQYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGK
QAMGVYTSNYQLRMDTLAHVLYYAQKPLVMTRAMEFMYFKELPSGCNAVVAIACYTGXAH
VLYYAQKPLVMTRAMEFMYFKELPSGCNAVVAIACYTGYNQEDSVIMNQSSIDRGLFRSV
FYRTYENQAKVTGGADEEFHKPSPETTVGIRFGCYDKLDDDGLIIPGHRVTGDDIIIGKT
AALNLNTGVSRQTRKDASISLRHSESGIIDSVLLTVDDQGHRFTKIRMRSIRIPQIGDKF
ASRHGQKGTIGQTFRQEDLPFTHQGISPDIIVNPHAIPSRMTIGHLIECLASKVACLRGE
EGDGTPFQSVTVEDIATDLQKLGYQRYGNEVMYNGHTGNRLEAQIFLGPTYYQRLKHMVD
DKIHSRARGQVQTLTRQPTEGRSRGGGLRFGEMERDCMISHGSARFLKERLFDTSDAYRV
HICENCGLFAIANLDRNIFQCKQCKNKKAKISQIFIPYACKLLFQELMAMHIAPRLHTSV
C


>SteCoe_22675(CDS)
ATGGAAGACGAGGATCTAAGTCAAGAAGATGCATGGGTTGTTATTTCAGAATATTTCAAA
GAAAATGGTCTTGTGAGCCAACAATTATCATCTTTTAACTATTTTATCCTACATACCATT
CAAGAAATCATTGAAGATAGTGCTGAAATCACCATTATTCCTGAAAGACAATATCGTCCT
GGAGAACGATTACAACATGAACTGAAATATGTAATCAGCTTCAAACAAGCTACTTTAGGT
GCACGACCAGTCCTTAAAGAGCATACAGGTGGTTCAAACCTAATTTTCCCTAATGAGGCA
AGACTTAGAAATTTAACATACGCATCAAACCTTTTAGTCGACGTGCAAAAACAGGCAATC
GTCAATTTTGGGGATGGAAAAGGAGAAAACCCAGAAGAAGAAGAGGAACAAAAAGGTGTG
TTCATTGGAAGAATTCCTATCATGGTCCGATCTAACTATTGTGCCTTACACAAAAAAACA
GAAAAAGAAAGAATCACACATAAAGAATGTGTTTTTGATCAAGGTGGGTACTTTATTATC
AATGGTAAAGAGAAAGTCTTAGTGGCACAAGAAAAAATGGCCAATAACTTTGTTTATGTC
TTTCACAAAAACCAGCCTTCAAAGCATTCTTGGATTGCAGAAATTCGTTCGCAAAATGAG
TCGACCAATAAAGTTCCATCAGCTTTTTCTATTAAACTTATGACCAAACAAGGATCAAAA
TCTTCACATGAACAAGTTATTCGTGCTAATTTACCTTATGTTAAATCTGATATTCCAGTT
GTTGTTTTATTTAGAGCTATGGGTTTTGTTTCAGATCGTGATATTATTAGTCATATTTGT
TATGATAGTAGTGATGTAAGGATGATGGAATTACTTAGGCCATCACTTGAAGAAGCTTAT
GATATCCCTTCACAAGAAGTAGCTTTGGATTTTATAGGTCGTCGTGGTAATTCAGTAGGT
GCTCAAAAAGAACAGCGTATAATATATGCAAGGAATCTTTTACAAAAAGAAATGGTCCCA
CATGTAAGTGTATCATCTGAATATGAGACTAAAAAAGCATTTTTTGTTGGGTATATGGTG
AATCGTCTTTGTAATGCTGCTCTTGGAAGAAACCCAGAAGATGATCGTGACCATTATGGT
AAGAAAAGGCTGGACCTAGCCGGGTCTTTGTTGGCAGGTCTTTTCAGACAACTTTTTAGA
AGATTTACTAAAACAGCTCAGGAAGTTATGAAAAAACAAGTAGATTCTCAGCATGATATC
AACTTAGTATCAGCTGTAAAAGAACATATTATTACTCATGGACTCAGATATGCTTTAGCT
ACAGGTAATTGGGGAGTGGATAAATCTGGAGCTGTAGCAAAAACAGGTGTTAGCCAAGTA
CTTAGCAGATTGACTTTTTCTTCATCTTTATCCCATTTACGTAGATTAAACACCCCATTA
CAAAAACAAGGAAAACTAACAAAACCAAGACAATTACACAACACTCATTGGGGAATGATT
TGTCCTGCTGAAACTCCTGAAGGTCAAGCATGTGGACTAGTAAAAAATTTAACACTTATG
GCTCATATATCTGTAAGTTGTAATTCTTCTCAATTGCAAAGAATGCTTGAAGAACTTAAT
ACAGAAAACCTTGTTGAGCTTAGTGTTAGAAATATTCATGACAGGACTAAAGTGTTTTTT
AATGGTTCATGGATTGGTATTCATGGAGATGCGGAGTATCTAATAAAAACTTTAGTTTCA
TTAAGAAGACAAGGGCTTATTCCAAAGCAAGTTTCTATTGTAAGAGATATTCCTAACAAA
GAAATTAGATTATATTCAGATTCTGGACGTGTACAAAGACCATTATTTATTGTTGAAGAT
TGTAGACTAAAAATGACTAAGGAACATATAGAAAAATTCAAACTTCCTAGAGAACATCCT
TCACATTTGAGTTTTGAAAAATGTACAGAAATGGGTTTAATCGAATATCTTGATACAGAA
GAAGAAGAAACTTCAATGATATCCATGATGATGAAAGATCTTCAAGATAGTAAAAATAAA
TATCAATACACACATTGTGAAATCCATCCTTCTATGATTTTAGGAGTCTGTGCATCAATT
ATTCCTTTTCCAGACCATAATCAATCTCCACGTAATACATATCAAAGTGCTATGGGTAAA
CAAGCTATGGGTGTTTATACAAGTAATTATCAACTTCGTATGGATACTTTAGCCCATGTT
CTTTATTATGCACAAAAACCTTTAGTTATGACTAGAGCTATGGAGTTTATGTATTTTAAA
GAACTACCAAGTGGATGTAATGCAGTGGTTGCTATTGCTTGTTATACAGGTNTAGCCCAT
GTTCTTTATTATGCACAAAAACCTTTAGTTATGACTAGAGCTATGGAGTTTATGTACTTT
AAAGAACTACCAAGTGGATGTAATGCAGTGGTTGCTATTGCTTGTTATACAGGCTACAAT
CAAGAAGACTCAGTAATTATGAATCAATCTTCTATTGACAGAGGTTTATTCCGTTCAGTG
TTTTATAGAACTTATGAAAACCAAGCTAAAGTTACTGGTGGAGCTGATGAAGAATTCCAT
AAACCAAGTCCTGAAACTACTGTTGGAATCAGATTCGGCTGTTATGATAAATTAGATGAT
GATGGGTTGATAATCCCTGGTCATCGAGTTACAGGCGACGATATTATCATTGGTAAAACC
GCAGCACTTAACTTAAATACTGGAGTTTCAAGACAAACACGTAAAGATGCATCAATTTCT
CTTAGACATAGTGAATCTGGTATTATTGATTCAGTACTTTTAACTGTTGATGACCAAGGT
CATAGATTCACTAAAATAAGAATGCGTTCTATCAGAATCCCACAAATCGGAGACAAATTC
GCTAGTCGTCATGGACAAAAAGGAACTATTGGGCAAACTTTTCGTCAAGAAGATCTTCCT
TTTACTCATCAAGGTATAAGTCCTGATATTATTGTCAACCCTCATGCTATACCTTCACGT
ATGACAATTGGCCATTTAATTGAATGTTTAGCTAGTAAAGTAGCTTGTCTTCGAGGTGAA
GAAGGTGATGGAACTCCATTTCAAAGTGTTACTGTTGAAGATATAGCAACTGATTTACAA
AAACTTGGATATCAAAGATATGGTAATGAAGTTATGTATAATGGACATACTGGGAATAGA
CTTGAAGCACAAATTTTCTTAGGACCAACTTATTATCAGAGACTTAAGCATATGGTTGAT
GATAAGATTCATTCTAGAGCTCGTGGTCAAGTTCAAACATTAACAAGACAACCAACTGAA
GGTAGATCAAGAGGTGGTGGGCTTAGATTTGGTGAAATGGAAAGGGATTGTATGATTTCA
CATGGATCTGCTAGGTTTTTGAAAGAAAGGCTTTTTGATACTAGTGATGCTTATAGAGTG
CATATTTGTGAAAACTGTGGGCTTTTTGCTATTGCTAATTTAGATAGAAATATTTTCCAA
TGCAAGCAATGCAAAAATAAGAAAGCGAAAATATCACAGATATTCATACCTTATGCTTGC
AAACTTTTATTCCAAGAACTAATGGCTATGCATATTGCCCCAAGACTTCATACATCAGTA
TGCTAA