Identifiers and Description

Gene Model Identifier

SteCoe_22698

Standard Name

None

Aliases

None

Description

Tudor-knot domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • transferase activity, transferring acyl groups other than amino-acyl groups (IEA) | GO:0016747

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig14180.0.g373.817497188671175e-54MOZ/SAS family

Tetrahymena ThermophilaTTHERM_003102405.665668176358939e-52MOZ/SAS family protein
WormBaseWBGene000070295.5210822770285325e-42
Saccharomyces CerevisiaeYOR244W4.4737793061811207e-38Catalytic subunit of the histo
ne acetyltransferase complex (
NuA4); acetylates four conserv
ed internal lysines of histone
H4 N-terminal tail and can ac
etylate histone H2A; master re
gulator of cellular acetylatio
n balance; required for cell c
ycle progression and transcrip
tional silencing at the rDNA l
ocus and regulation of autopha
gy; human ortholog TIP60/KAT5
is implicated in cancer and ot
her diseases

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22698(Protein)
MRRGNKKDNRERKSSDMEQEGPFKVNQLILAQNKSNTYSVGEWRDAKVISIRSGSKSNIN
LEDSIELYVHYERTNRRCDEWIPTDRAKPWEASSKKAETNEPILEHDEHEGYDEKVIAMH
EECTKFKTIRYIELGKHRCETWYFSPFPDYYQNIDTLYICEFCLTFFKFKAELVRHEKRC
KILHPMGNEIYRDGDISVFEIDGARNVAYCENLCYISKLFLDHKNLSYDVEPFLFYVLTE
NDDAGCHIAGYFSKEKESTMNNNLSCILVLPFMQRKGFGKFLITFSYELSKIELKVGTPE
RPLSDLGYASYFSWWTGEIVRVLESHQGQMLSLNDVTNKTYIRHQDVMEILDKLNILRYC
QGNHILYANPEYLNEIKKTIVGKPGRPVYPEKLHWRPLKIIN


>SteCoe_22698(CDS)
ATGCGTAGAGGGAATAAAAAGGATAACCGTGAACGTAAGTCTTCAGATATGGAGCAAGAA
GGCCCATTCAAAGTAAATCAGTTAATCCTAGCTCAAAACAAAAGTAACACCTATTCAGTT
GGCGAATGGAGGGATGCCAAGGTTATTAGTATTCGATCAGGTTCAAAAAGTAATATCAAT
TTAGAAGACTCAATAGAACTTTATGTTCATTATGAAAGGACCAATCGTCGTTGTGATGAA
TGGATTCCTACTGATCGTGCAAAGCCATGGGAAGCTAGTTCTAAAAAAGCTGAGACCAAT
GAACCTATTCTTGAACATGATGAGCATGAAGGATATGATGAAAAAGTTATAGCAATGCAT
GAAGAATGTACTAAATTCAAAACTATCAGATATATTGAATTAGGTAAACATCGTTGTGAA
ACTTGGTACTTTTCCCCATTCCCTGATTATTATCAAAACATCGATACACTTTACATCTGC
GAGTTCTGTCTTACTTTCTTCAAATTCAAAGCTGAACTTGTCCGACATGAAAAAAGGTGT
AAAATCCTACATCCAATGGGCAATGAAATATATAGAGATGGGGATATTTCAGTCTTTGAA
ATCGATGGGGCGAGGAATGTTGCTTATTGTGAAAATCTTTGTTATATATCAAAGCTTTTT
CTTGATCATAAGAATTTAAGCTATGATGTTGAGCCTTTTTTATTCTATGTGCTAACTGAA
AATGATGATGCTGGGTGTCATATTGCTGGATATTTTTCTAAGGAAAAAGAGTCTACTATG
AACAATAATTTGTCATGTATTTTAGTCTTACCTTTTATGCAAAGGAAGGGTTTTGGTAAA
TTTTTGATAACATTTTCATATGAACTTAGTAAAATTGAATTAAAAGTTGGAACACCTGAA
AGACCACTTTCTGATTTGGGATATGCTTCGTATTTTAGTTGGTGGACTGGGGAGATTGTT
AGGGTGTTAGAAAGTCATCAAGGACAGATGTTATCACTTAATGATGTTACGAATAAGACG
TATATAAGACATCAGGATGTTATGGAGATTTTGGATAAGCTGAATATTTTGAGGTATTGT
CAAGGAAATCATATATTGTATGCTAATCCAGAGTATTTGAATGAGATTAAGAAGACTATT
GTTGGAAAACCTGGGAGGCCTGTGTATCCTGAGAAACTTCATTGGAGACCTTTGAAGATT
ATTAATTAA