Identifiers and Description

Gene Model Identifier

SteCoe_22752

Standard Name

None

Aliases

None

Description

FA_hydroxylase domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003482301.7587922024243116e-25Sterol desaturase family prote
in
Oxytricha TrifallaxContig18492.0.g714.780892883885469e-25Fatty acid hydroxylase superfa
mily

Saccharomyces CerevisiaeYGR060W0.0000000000002543665647376923C-4 methyl sterol oxidase; cat
alyzes the first of three step
s required to remove two C-4 m
ethyl groups from an intermedi
ate in ergosterol biosynthesis
; mutants accumulate the stero
l intermediate 4,4-dimethylzym
osterol

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22752(Protein)
MVIEKVKRLFGYEADKIRYRSFGCFLAGILSLSYFYYVPRVLFYFYDYMPWDNLYIMYTL
GSYTSHLFAYVLINLGFYFLYTRNWNSIEKWKISPGPWPWANKNKYDEDKKKLIKTALFN
QIITLPVSLAIIGLRVKYIITPQEPDFITTLKQVAFFIVCEDFFFYWSHRMLHLPWFYKK
IHKKHHEYQNSISPAAEYAHPFEYIFGNSLPVASGPILYGQSNVHIITWFTWVMFRTCNT
AEGHSGYDIPFSPFRFCPFSTSSSFHEFHHYKNVGNYGSFLAIWDTILDTGSAFFEYMEK
KEKVN


>SteCoe_22752(CDS)
ATGGTTATAGAAAAGGTCAAAAGGTTATTTGGCTATGAGGCTGATAAGATACGGTATAGA
AGTTTTGGGTGCTTTTTGGCTGGGATATTGAGTTTGAGTTATTTTTATTATGTCCCAAGA
GTATTGTTTTATTTTTATGATTATATGCCATGGGATAATCTTTATATCATGTATACTCTG
GGTTCATATACAAGTCATTTGTTTGCATATGTTCTTATTAACTTAGGATTTTACTTTTTA
TATACCAGGAACTGGAATAGTATAGAGAAATGGAAAATATCCCCAGGGCCATGGCCCTGG
GCTAACAAGAACAAATATGATGAGGATAAAAAAAAACTTATAAAAACAGCGCTTTTCAAT
CAGATAATTACTTTACCTGTATCTCTTGCTATAATAGGTTTAAGGGTTAAATATATTATA
ACACCTCAAGAACCTGATTTTATAACAACACTTAAACAAGTTGCGTTTTTTATAGTATGT
GAAGACTTTTTCTTTTATTGGTCACACAGAATGCTTCATCTACCATGGTTTTATAAGAAA
ATCCATAAAAAACATCATGAATACCAAAATAGTATTAGTCCAGCAGCTGAATATGCTCAT
CCATTTGAGTATATTTTTGGGAATTCTTTACCAGTTGCTTCTGGACCGATTTTATATGGC
CAATCTAATGTGCATATAATAACATGGTTTACTTGGGTCATGTTTCGTACTTGTAATACT
GCTGAAGGCCATTCAGGATATGATATTCCATTTAGTCCATTTAGGTTTTGTCCCTTTAGC
ACAAGTTCTTCTTTTCACGAATTCCATCACTATAAAAATGTTGGCAATTATGGGAGCTTT
CTCGCTATATGGGATACTATATTAGATACTGGTAGTGCATTTTTTGAGTATATGGAAAAG
AAAGAAAAGGTCAACTAA