Identifiers and Description

Gene Model Identifier

SteCoe_22784

Standard Name

None

Aliases

None

Description

Metallophos domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig6051.0.g681.2160992992528256e-37Calcineurin-like phosphoestera
se

Tetrahymena ThermophilaTTHERM_007214502.6786369618080778e-33Ser/Thr protein phosphatase fa
mily protein.
Mre11p is requir
ed for the repair
of meiotic d
ouble-strand breaks and full c
hromosome pairing.
Saccharomyces CerevisiaeYMR224C1.185064864233981e-27Nuclease subunit of the MRX co
mplex with Rad50p and Xrs2p; c
omplex functions in repair of
DNA double-strand breaks and i
n telomere stability; Mre11p a
ssociates with Ser/Thr-rich OR
Fs in premeiotic phase; nuclea
se activity required for MRX f
unction; widely conserved; for
ms nuclear foci upon DNA repli
cation stress
WormBaseWBGene000034052.3802664086944007e-26

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22784(Protein)
MNSVFKIMIATDNHLGYMEKDPIRKNDSFNTVEEVFIQTHKLNCDFLLLGGDLFHESSPS
KDTLHRTLNMFAKYVIGQKPIQFETLTQLERMNYLNQFIKISLPVFIVHGNHDDPSAETG
VSALNIMQSANYLNYISGIYESDVLKLNPIVLKKQDTKIAIYGIGNMKEDKLNQMLIGGK
IIFEKPENCRDYVFILVVHQNRFKGSGQGPSAKNCIMDWAFPEFFDLIVWGHEHDCYTVP
RTTENRGYVIYQPGSSVATSLTDGEAREKHMFLLEIRRVAYKVTPIPFKTTRKVLFKSLE
LADLCQDTAQAEIMVEKIFEELIENSREDIEKGFFPLVRIKIEATGFEGFRGFLINSKIN
QKTANKDVICVWKRITRETNDKENIQISGTGPFDDIMKIFDDNLEDNQQIFKIYNTKQFM
RSVVDFTSKGDLKSMEEYFNVKAEMALQKIVTSVGAFDEAVIKKKIDELDISEDEPSYKR
KTGEGRSEKKIKTL


>SteCoe_22784(CDS)
ATGAATAGTGTATTCAAAATCATGATCGCAACAGACAATCACCTTGGCTATATGGAAAAA
GACCCAATTCGTAAAAACGATTCTTTCAATACAGTAGAAGAAGTGTTTATCCAAACACAT
AAACTAAACTGTGACTTCCTTCTTCTTGGCGGGGATTTATTTCACGAAAGTAGCCCTAGT
AAAGATACTCTTCACAGGACTTTAAACATGTTTGCAAAGTACGTTATAGGCCAAAAGCCA
ATACAATTTGAAACTTTAACCCAATTAGAAAGAATGAATTACTTAAACCAATTTATAAAA
ATTAGTTTGCCAGTGTTTATTGTACATGGAAACCATGATGACCCATCAGCAGAAACTGGA
GTATCTGCTTTAAATATAATGCAAAGTGCAAATTATTTAAATTATATATCAGGAATATAT
GAAAGTGATGTGCTAAAATTAAACCCAATAGTACTTAAAAAACAAGATACAAAAATCGCG
ATTTATGGTATTGGGAATATGAAAGAAGATAAATTGAATCAAATGCTAATAGGAGGTAAG
ATAATATTTGAAAAGCCTGAAAACTGTAGAGATTATGTTTTTATATTAGTCGTTCATCAG
AATCGATTTAAAGGAAGTGGGCAAGGTCCATCAGCTAAGAATTGTATTATGGATTGGGCT
TTTCCTGAATTTTTTGATTTAATTGTATGGGGACATGAGCATGATTGTTATACAGTTCCT
AGAACTACTGAGAATAGAGGATATGTGATTTATCAACCTGGGTCTTCTGTGGCTACATCG
CTTACTGATGGTGAAGCTCGAGAAAAACATATGTTTTTACTTGAAATACGAAGAGTTGCT
TATAAAGTTACCCCGATTCCTTTTAAAACAACAAGAAAAGTGTTGTTTAAAAGTCTTGAA
CTTGCTGATCTTTGTCAAGATACTGCTCAAGCTGAGATTATGGTTGAAAAGATATTTGAA
GAACTAATAGAAAACTCAAGAGAAGATATTGAAAAAGGCTTTTTCCCTTTAGTTAGAATC
AAAATTGAAGCAACAGGTTTTGAAGGATTTCGTGGATTTTTAATTAATTCGAAGATCAAT
CAGAAAACTGCAAATAAAGATGTGATTTGTGTATGGAAAAGAATTACTAGAGAAACAAAT
GATAAAGAGAATATACAAATTAGTGGCACTGGACCTTTTGATGATATTATGAAAATTTTT
GATGATAATTTGGAGGATAATCAGCAAATATTTAAGATTTATAATACAAAACAATTTATG
AGGAGTGTTGTGGATTTTACTAGTAAAGGTGATTTGAAAAGCATGGAAGAGTATTTTAAT
GTTAAAGCAGAAATGGCTTTGCAGAAGATTGTGACTAGTGTTGGGGCGTTTGATGAGGCT
GTTATTAAAAAGAAAATTGATGAGCTTGATATAAGTGAAGATGAACCAAGTTATAAAAGG
AAAACTGGAGAAGGAAGATCTGAAAAGAAAATTAAAACTTTATAA