Identifiers and Description

Gene Model Identifier

SteCoe_22820

Standard Name

None

Aliases

None

Description

RCK family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig10393.0.g631.0648786602415064e-63Protein kinase domain

Tetrahymena ThermophilaTTHERM_013479001.9006199352650016e-55Protein kinase domain containi
ng protein. Sequence similarit
y to the RCK protein kinase fa
mily (Eisen et al., 2006)."
WormBaseWBGene000011212.820770088460135e-53
Saccharomyces CerevisiaeYDL108W4.780892883885469e-25Serine/threonine protein kinas
e, subunit of transcription fa
ctor TFIIH; involved in transc
ription initiation at RNA poly
merase II promoters; phosphory
lates Ser5 residue of the PolI
I C-terminal domain (CTD) at g
ene promoters; relocalizes to
the cytosol in response to hyp
oxia

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22820(Protein)
MERYKILKNVGDGTYGVVFKAINTANGEICAIKKMKTKFKSWDECLSLREIKSLRKLSHN
NIIKLKEAFRVNDELHLVFEFLDENVYQLIKDRTDPLPETRIRSITCQVLQGLAYMHKHG
FFHRDLKPENLMVSHEICKITDFGLAREIRSKPPFTDYVSTRWYRAPEILLRSTNYNSPV
DIFALGCIMAELYMLRPLAPGSNENDQMLKLCSVLGTPSMNIWPEGYKLASQMGYRFPQC
QPINFNSLLPSASYDAIQLILKMLSWDPQKRPTAVECLEHPFFASGVSAVEDSRFSSDAM
QRTGSKWSHGSSRIGGNSSKGKWSFKQGAQERKESALPKLKEVTEFSAMKPPHVPRPDIQ
KSREGEFLPPVYNPIKPVANPLRIASREKSSYLNDRVSSGYEKHHLNKPSNLYFPKVNPI
NHFGLSSSTVPKKLPPINSLSSVGSNIMGKPQSLGRLQY


>SteCoe_22820(CDS)
ATGGAGAGGTACAAGATTCTCAAAAATGTTGGAGATGGAACATACGGAGTGGTATTCAAA
GCAATAAATACAGCGAATGGAGAAATCTGCGCTATTAAAAAGATGAAGACTAAGTTCAAA
TCGTGGGATGAATGCTTATCTTTGCGAGAAATCAAGTCTCTTAGAAAACTGTCACACAAT
AACATTATAAAACTCAAAGAAGCCTTCAGAGTAAATGATGAACTACATCTTGTCTTTGAG
TTTTTAGACGAAAACGTTTATCAGCTGATTAAAGATCGTACAGATCCACTTCCAGAAACA
AGAATTCGTTCAATTACATGCCAAGTACTTCAAGGTCTAGCATACATGCATAAACATGGT
TTTTTTCACAGAGACTTAAAGCCAGAAAATCTGATGGTATCACATGAAATATGTAAAATT
ACAGACTTCGGCCTTGCAAGAGAAATCAGAAGCAAGCCACCATTTACTGATTATGTAAGT
ACCCGTTGGTATCGTGCACCAGAAATTTTATTAAGAAGCACTAATTACAACTCTCCTGTT
GATATTTTTGCTCTTGGGTGCATTATGGCAGAACTTTATATGCTTAGACCTTTGGCTCCA
GGAAGTAACGAAAATGATCAAATGCTGAAACTTTGTTCAGTACTGGGAACACCATCCATG
AATATTTGGCCTGAAGGCTATAAATTGGCTTCGCAAATGGGTTACCGCTTTCCTCAATGC
CAACCAATTAATTTCAATTCTTTATTACCTAGTGCGAGTTATGATGCAATTCAACTCATA
CTCAAAATGCTCTCTTGGGACCCACAGAAAAGGCCAACAGCTGTAGAATGCTTAGAACAT
CCATTTTTTGCTTCTGGGGTTTCTGCAGTTGAAGACTCAAGGTTTAGTTCTGATGCAATG
CAACGAACTGGGTCTAAATGGTCACATGGAAGTTCTAGAATTGGAGGCAACAGTTCGAAA
GGTAAATGGTCTTTCAAGCAAGGTGCACAAGAAAGAAAAGAATCAGCTTTACCGAAACTA
AAAGAAGTAACTGAATTCTCTGCAATGAAGCCTCCTCATGTGCCAAGACCTGATATTCAA
AAATCTAGGGAGGGTGAATTTTTACCTCCAGTTTATAATCCTATCAAGCCGGTTGCAAAT
CCTTTGAGAATAGCTAGCCGAGAAAAGTCTAGCTATTTGAACGATAGAGTTAGTTCTGGC
TACGAAAAGCATCATCTTAATAAGCCTAGCAATCTTTATTTCCCAAAAGTAAATCCTATC
AATCACTTTGGACTGAGCAGCTCTACTGTACCAAAGAAACTTCCCCCAATCAACTCTTTG
TCTTCTGTTGGCAGCAATATTATGGGAAAACCCCAATCATTAGGTAGACTTCAATATTAA