Identifiers and Description

Gene Model Identifier

SteCoe_22962

Standard Name

None

Aliases

None

Description

zf-Sec23_Sec24 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig4011.0.g809.462629465836378e-57Sec23/Sec24 trunk domain

Tetrahymena ThermophilaTTHERM_000732008.194012623990515e-40Sec23/Sec24 trunk domain conta
ining protein
WormBaseWBGene000047551.462486227251231e-31
Saccharomyces CerevisiaeYIL109C3.221340285992516e-27Component of the Sec23p-Sec24p
heterodimer of the COPII vesi
cle coat; required for cargo s
election during vesicle format
ion in ER to Golgi transport;
homologous to Sfb3p; SEC24 has
a paralog, SFB2, that arose f
rom the whole genome duplicati
on

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_22962(Protein)
MSEGSRLPHLQRPYYQTSEPAPTTTPAPLPKPVQREQKLQTETLPRPLNRQDNHLGVFTT
IGQLPPSPDSLFSVKEQGLSNPKNLRFTMNSIPTEMSMCNNIGIPLGAVWQPLAELPQDD
EQIQKIESPPFRCTRCLAYVNTFFKFTDSGRNCTCNICGLSLDIPEIYIRDRASKPELYA
GTYDFIAPADYSNRPTQIPLFLFVVDVSAPALQLRIIHQVVASIRNILDSLPYPDKTLIG
IITFDNSIQIYKIAANGELIEIVMTDLDDPFISESVSGCCYNAESDRDKFDALLYKLSEW
SFPNANKQSLSAGGVIHAVKEYLLKSRGGRVLLFTSQTGSVGKHVIPPKQEFKPMHTERE
KAYLPADNYLQLGQDCCSEDICVDIFACTHQTINSASLASLCSQTGGDFYYYPAFQAETD
GEKLYYQIVRILTRPQGSQVVMRARCSNGLAIDYYIGKYKRKGPVEMEAACIDSDKSIAI
IIKYDEKLKEATDFYVQCAMLYTTAQGQRLIRISNGKLFSTRSIPNILKSADVDTIANVV
SRISAQNIFEIPLNTIRENWHNNIIKLLIAHRQSLGDNDFSKILVPDTLKLLPLYCNSAL
KQSGLTISITPMDQRINSIYNILSLPVYSSRLLLYPKIYSIGDIQNQSHQPGTFSDNSIL
ILPRLVGDSHEFIKPDGVYLINNGEIIMIYIGKDASNEFIYNVWGFDGPQDLFNNVDYWP
ISDNGNEENEKVLNIIQDVRSRNPSVYASIYMFFEGLSKDDGVVKRMLVEDNNTSELAYG
DFLMRVHKVVLNKISRND


>SteCoe_22962(CDS)
ATGTCTGAAGGGTCTAGACTTCCTCACTTACAAAGGCCATATTACCAAACTTCAGAACCA
GCTCCGACTACAACTCCAGCTCCTCTACCGAAACCAGTACAAAGAGAACAAAAGCTTCAA
ACTGAAACCCTTCCCAGACCTTTGAATCGTCAAGATAATCATTTAGGAGTTTTCACAACC
ATAGGACAATTACCCCCAAGTCCAGATAGTCTTTTTTCTGTCAAAGAACAAGGTTTATCA
AACCCAAAAAACCTTCGTTTTACAATGAACTCAATACCTACAGAAATGAGTATGTGTAAT
AATATTGGTATTCCATTAGGTGCAGTATGGCAACCACTTGCTGAACTTCCTCAAGATGAT
GAACAAATTCAAAAAATCGAAAGCCCTCCTTTTAGATGTACAAGATGTCTTGCTTATGTT
AATACTTTTTTCAAATTCACAGACTCAGGAAGAAATTGCACTTGTAATATTTGTGGGTTA
AGTCTTGATATTCCTGAAATTTATATTAGAGATCGAGCTTCTAAACCTGAATTATATGCT
GGGACATATGATTTTATTGCTCCAGCTGATTATTCTAATAGACCTACACAAATACCTTTG
TTTTTATTTGTTGTTGATGTTTCTGCACCAGCTTTACAGTTGAGAATTATACATCAAGTT
GTTGCTTCTATTAGGAATATATTAGATTCTTTACCTTATCCTGATAAGACACTTATAGGG
ATTATTACTTTTGATAATAGTATTCAGATATATAAAATTGCAGCTAATGGGGAATTGATT
GAAATTGTTATGACTGATTTGGATGATCCATTTATATCTGAGTCTGTATCTGGATGTTGT
TATAATGCAGAGAGTGATAGAGATAAGTTTGATGCGCTTTTGTATAAACTAAGTGAATGG
AGTTTCCCTAATGCTAATAAACAGAGTCTTTCAGCTGGAGGGGTAATTCATGCTGTTAAA
GAGTATTTACTTAAAAGCCGTGGAGGAAGGGTGTTGCTTTTTACTAGTCAGACTGGATCT
GTTGGGAAACATGTAATACCCCCAAAGCAAGAATTCAAACCTATGCATACTGAAAGAGAA
AAAGCTTATTTGCCAGCTGATAATTACTTGCAGCTTGGTCAAGATTGTTGTTCTGAAGAT
ATATGTGTTGATATTTTTGCTTGTACACATCAAACTATAAACTCAGCTAGCCTAGCAAGT
CTTTGTAGTCAAACAGGAGGGGATTTTTACTATTATCCAGCTTTCCAAGCTGAAACTGAT
GGAGAAAAACTATATTATCAGATTGTCAGAATATTAACAAGGCCACAAGGGTCACAAGTA
GTCATGAGAGCTCGATGCAGTAATGGATTAGCTATTGATTATTACATAGGGAAATACAAA
CGTAAAGGACCAGTAGAAATGGAAGCAGCATGTATAGACAGTGACAAAAGTATAGCAATT
ATTATAAAATACGATGAGAAACTCAAAGAAGCCACTGATTTCTACGTCCAATGCGCTATG
CTCTATACAACTGCCCAAGGTCAAAGACTTATCCGTATTTCAAACGGTAAACTTTTTTCT
ACCCGCAGTATCCCCAACATCTTAAAATCAGCTGACGTAGACACAATCGCCAATGTAGTC
AGTAGAATCTCTGCTCAAAACATATTCGAAATTCCTCTAAACACAATCCGTGAGAACTGG
CATAACAATATAATCAAACTTTTAATTGCCCATAGACAATCCTTAGGTGATAATGACTTT
TCTAAAATCCTCGTCCCAGATACTTTAAAACTCTTACCTCTTTATTGTAACTCTGCACTT
AAACAATCAGGTTTGACAATATCAATAACCCCTATGGATCAAAGAATAAATTCTATATAC
AACATCTTAAGTTTACCAGTATATTCATCAAGATTACTTTTATATCCAAAAATATATAGT
ATTGGGGATATTCAAAACCAATCTCATCAGCCAGGAACTTTTTCTGATAATTCAATTCTT
ATCCTCCCAAGACTTGTTGGTGATTCTCATGAGTTTATAAAACCAGATGGTGTTTATTTA
ATAAACAATGGAGAAATTATAATGATTTATATAGGTAAAGATGCAAGTAATGAATTCATA
TACAATGTTTGGGGTTTTGATGGACCTCAAGATTTATTCAATAATGTTGACTATTGGCCA
ATTAGTGATAATGGGAATGAGGAAAATGAAAAAGTCTTAAATATTATCCAAGATGTGAGA
TCTAGGAATCCATCAGTATATGCATCTATATACATGTTTTTTGAAGGATTAAGTAAAGAT
GATGGGGTTGTTAAAAGGATGCTTGTTGAAGACAATAATACATCAGAACTTGCTTATGGG
GATTTTTTAATGAGAGTTCACAAAGTTGTATTGAACAAAATTAGTAGAAACGATTAA