Identifiers and Description

Gene Model Identifier

SteCoe_23097

Standard Name

None

Aliases

None

Description

Ribosomal_S4 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004340701.6458114310822737e-38Homolog of yeast RPS9, human R
PS9, bacterial RPS4;
WormBaseWBGene000044784.4737793061811207e-38
Saccharomyces CerevisiaeYBR189W2.4426007377405277e-36Protein component of the small
(40S) ribosomal subunit; homo
logous to mammalian ribosomal
protein S9 and bacterial S4; R
PS9B has a paralog, RPS9A, tha
t arose from the whole genome
duplication
Oxytricha TrifallaxContig18343.0.g856.639677199580735e-36Ribosomal protein S4/S9 N-term
inal domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23097(Protein)
MTKSYRKRSRTSKTPRRPFEKERLDQEMMLMGQYGLKNKREVWRVQLTLAKIRKAARELL
TLEETHPRRIFEGNALIRRMVRLGLLNESEKKLDFVLGLTLQKFMERRLQTKVFKMNMAK
SIHHARVLIRQRHIRVGKQIVNVPSFLVRVDSEKYIEYDPNSSLSGGRPGRVKRRNLAKA
TKKDKGDEGDDD


>SteCoe_23097(CDS)
ATGACGAAGTCTTATAGAAAACGAAGTCGTACGTCTAAAACTCCACGAAGACCTTTTGAA
AAGGAAAGACTTGACCAAGAAATGATGCTTATGGGTCAATACGGGTTAAAAAACAAAAGA
GAAGTTTGGAGAGTTCAGTTGACTCTAGCTAAAATCAGAAAAGCTGCAAGAGAACTGCTG
ACTTTAGAAGAAACTCATCCAAGGAGGATTTTTGAAGGTAATGCGCTTATTCGTAGAATG
GTCAGACTTGGACTTTTAAATGAAAGTGAAAAGAAGCTTGATTTTGTCTTGGGCTTGACA
CTTCAGAAATTTATGGAAAGGAGACTTCAAACCAAAGTTTTTAAGATGAACATGGCCAAA
AGCATCCATCATGCTCGTGTGCTTATTAGACAAAGACATATTCGTGTTGGAAAACAGATT
GTCAATGTTCCAAGCTTCTTGGTTAGAGTTGATAGTGAGAAATATATTGAGTATGACCCG
AATTCATCGCTTAGTGGTGGACGCCCAGGACGTGTTAAGAGACGTAATTTGGCTAAAGCT
ACGAAAAAAGATAAGGGTGATGAAGGAGATGATGATTAG