Identifiers and Description

Gene Model Identifier

SteCoe_23149

Standard Name

None

Aliases

None

Description

ANAPC4_WD40 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig4092.0.g708.074506789675094e-73WD domain, G-beta repeat

Tetrahymena ThermophilaTTHERM_010051208.854771883513433e-70fizzy/CDC20/CDH1 family protei
n; homolog of S. cerevisiae CD
H1, a cell cycle regulated act
ivator of the anaphase-promoti
ng complex /cyclosome (APC/C),
which directs ubiquitination
of various targets
WormBaseWBGene000015104.2960271311739114e-61
Saccharomyces CerevisiaeYGL003C4.590938473882946e-48Activator of anaphase-promotin
g complex/cyclosome (APC/C); c
ell-cycle regulated; directs u
biquitination of cyclins resul
ting in mitotic exit; targets
the APC/C to specific substrat
es including Cdc20p, Ase1p, Ci
n8p and Fin1p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23149(Protein)
MQLDSPTKSIIRKGSLNENDKYSERFIPNRTSLTLLSSFDKLSDDRVLLSQNYDEQHAAY
STLLHTQFSQAPNSGLFRKTLFKFSTENPGKENQVTELANEEIFSPLKSQRKIPKSPFKV
LDAPALQDDFYLNLLDWSCGNQLSVGLGSCVYMWNAANSKVTKLCDLGLNDSVTSVAWSQ
NGTNISVGTNKGTILLWDAQRSKLLRSFSGHTGRVGALAWNNRILTSGSRDRQILHRDIR
AANESVARLFAHKQEVCGLKWSFDEQQLSSGGNDNKLMLWNLHSTQPVCKFPQHTAAVKA
MAWSPHQHGLLASGGGTADRTIRYWNTLTNEQVHCVDTGSQVCNLVFSKNTKELVSTHGY
SLNQIILWKDNDYSKVATLTGHTYRVLYLAMSPDGQTVVTGAGDETLRFWELFPDCKSQD
ICRKNVLLPSAYDLR


>SteCoe_23149(CDS)
ATGCAGTTAGATTCACCAACGAAGTCAATCATAAGAAAAGGGAGTCTTAATGAAAACGAC
AAATACTCCGAACGTTTTATCCCGAATCGGACCAGTCTGACCTTATTGAGTAGTTTTGAT
AAACTCAGTGATGACAGGGTGTTACTAAGCCAAAACTACGACGAACAACACGCTGCTTAC
TCAACTTTACTACACACGCAGTTTTCCCAAGCTCCAAACAGTGGTTTATTCCGTAAAACC
CTATTCAAATTTTCTACTGAAAACCCAGGGAAAGAAAATCAAGTCACTGAATTAGCAAAC
GAAGAGATCTTTTCCCCATTAAAATCCCAAAGAAAAATCCCAAAGTCTCCTTTTAAAGTC
CTTGATGCCCCTGCATTACAAGACGACTTTTATCTGAATTTACTTGACTGGTCTTGTGGA
AACCAATTAAGTGTCGGCTTAGGTTCTTGTGTTTATATGTGGAACGCAGCTAATTCAAAA
GTTACAAAACTATGCGACTTAGGTTTAAATGACTCTGTAACAAGTGTAGCCTGGTCACAA
AATGGGACAAATATTTCTGTTGGGACAAATAAAGGGACAATACTTTTATGGGATGCTCAA
AGATCTAAACTCTTAAGAAGCTTCTCAGGACATACAGGAAGAGTTGGAGCTCTTGCATGG
AATAATCGTATTCTCACTTCAGGATCTAGAGATAGACAGATTTTACATAGGGATATAAGA
GCAGCTAATGAATCTGTAGCAAGATTATTTGCCCATAAACAAGAAGTCTGTGGATTGAAA
TGGTCTTTTGATGAACAACAACTTAGTTCAGGAGGTAATGATAATAAACTTATGCTTTGG
AATTTACATTCAACACAACCTGTATGTAAATTTCCTCAACATACTGCTGCGGTTAAAGCT
ATGGCCTGGTCTCCACATCAACATGGACTTTTAGCTTCAGGTGGAGGTACAGCTGATAGG
ACAATAAGATATTGGAATACTTTAACTAATGAACAAGTACATTGTGTTGATACTGGGTCA
CAAGTTTGTAATTTGGTTTTTTCTAAAAATACTAAAGAACTTGTGTCAACACATGGTTAT
TCTTTGAATCAGATTATATTGTGGAAAGATAATGATTATAGTAAGGTTGCTACTTTGACT
GGGCATACTTATAGAGTTTTGTATTTGGCGATGAGTCCTGATGGGCAGACTGTGGTCACT
GGAGCTGGAGATGAGACTTTGAGGTTTTGGGAACTTTTCCCGGATTGTAAAAGTCAGGAT
ATTTGTAGGAAAAACGTACTTTTACCTAGTGCTTATGACTTGCGATAA