Identifiers and Description

Gene Model Identifier

SteCoe_23171

Standard Name

None

Aliases

None

Description

DEAD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig3639.0.g110Oligonucleotide/oligosaccharid
e-binding (OB)-fold

WormBaseWBGene000033920

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23171(Protein)
MELKSWINDKLYEIIGMSEKNTVDYVFVLASSAKSQEEICEKLIDIDFPDSQKTRNFAEN
LYKKLSPAEPQPISTYQQKFNEDLAKKVKNESYELIHEPYDPKTDQKEKDELNKRLIKRE
KTSREKKQKHLEMTDEERKKLVQDMKKISRWKYLEQREEQQLDLMRRQIEDEEQLFKGVK
LTEKEVKEHELNKKIYSIALEKTQQRQEVLGFKMQDEYDDIKGGKIEDRFKVLYKRYEEE
KHTKTEQEVWENAQTSRSKYNYGNKEVKFQQNYDLLLDNQIDYIKTQLIEGNFEEDERFE
RFSKADRLQDERCELPVFKQRDKLLTAIRDHKILIVEGETGSGKTTQIPQYLHEVGYTKY
GKIACTQPRRVAAMSVAARVAQEMRVKLGHEIGYSIRFEDCTSETTVIKYMTDGMLLREF
MMDPELSSYSVVMIDEAHERTLHTDILFGLIKDLARARNNLKVIISSATMDAEKFARYFD
NAPIFGIPGRRFPVDVFYTKSPEADYIEAAVITVLQIHVTQPAGDILVFLTGQEEIESTH
DILLSRTRGLGTKIPELIILPIYSNLPSEMQAKIFEPTPEGARKVVLATNIAETSVTIDG
IIYVIDCGLCKETCYNPRTGMESLVIVPISKASARQRAGRAGRVAPGKCFRIYTLWSYDN
ELEENPVPEIQRCNLGNVVLILKSLGIEDLVHFDFLDPPASETLIRALEELYALGALNDE
GQLTKLGRRMAEFPVDPKLSKCIMYSEKYSCTNEVATIAAMLSVGNSVFFRPKDKIMHAD
NARMSFSCRDGDHLTLFNVYSQWEEANFSSIWCRDHFIQYRSMNKARDIKEQLVDLCERV
EIIVNKEPCKDIKMVIKSFCSGYFFNCARLHKSGIYKTVKNAHTVFIHPSSVMFKEMPKW
VMYHELVLTSKEFMRHASIMSSQWLTELAPHYFSSQDLDDDSIKKMPKPIKLNP


>SteCoe_23171(CDS)
ATGGAGTTAAAGTCTTGGATCAATGACAAGCTTTATGAAATTATCGGCATGTCTGAAAAA
AACACAGTCGACTACGTCTTTGTCCTTGCTAGTTCAGCCAAATCCCAAGAAGAGATTTGT
GAAAAACTCATTGACATTGATTTCCCTGACAGTCAGAAAACTCGTAATTTCGCTGAAAAT
TTATATAAAAAACTCTCACCAGCAGAGCCACAACCAATAAGCACTTATCAGCAAAAGTTC
AATGAAGATCTCGCTAAAAAAGTTAAAAACGAGTCTTATGAATTGATTCATGAACCTTAT
GACCCGAAAACTGATCAAAAAGAAAAAGATGAGTTAAATAAACGTTTGATTAAAAGAGAG
AAAACTTCAAGGGAAAAAAAACAGAAGCATCTTGAAATGACTGATGAAGAAAGGAAAAAA
TTAGTTCAGGATATGAAAAAAATCAGCAGATGGAAATATCTTGAACAAAGGGAAGAACAA
CAACTAGACTTAATGCGTCGGCAAATTGAAGATGAAGAACAATTGTTTAAAGGGGTGAAA
TTGACTGAAAAAGAAGTTAAAGAGCATGAGTTGAATAAGAAAATATACTCGATAGCTTTA
GAAAAAACACAACAAAGACAAGAGGTTTTAGGGTTTAAAATGCAAGATGAATATGATGAT
ATAAAAGGTGGGAAAATCGAAGATAGGTTTAAGGTTTTGTATAAAAGATATGAGGAAGAA
AAACATACAAAAACTGAACAGGAAGTATGGGAAAATGCACAAACATCAAGAAGTAAATAC
AATTATGGGAATAAAGAGGTTAAATTTCAGCAAAATTATGATTTACTTCTTGACAATCAA
ATTGATTATATAAAAACCCAGTTGATTGAAGGGAATTTTGAAGAAGATGAGAGGTTTGAA
AGATTTAGTAAAGCTGATAGACTACAAGATGAAAGGTGTGAATTGCCTGTTTTTAAACAG
AGGGATAAACTTTTAACTGCTATTCGGGATCATAAAATTTTGATTGTAGAAGGAGAGACA
GGATCAGGGAAAACCACACAGATTCCGCAATATTTACATGAAGTTGGGTATACAAAATAT
GGGAAAATTGCTTGTACACAGCCAAGAAGGGTTGCTGCGATGAGTGTTGCTGCAAGAGTT
GCTCAAGAAATGAGGGTTAAATTAGGACATGAAATCGGGTATAGTATACGTTTTGAAGAT
TGTACATCAGAAACTACAGTTATCAAATATATGACTGATGGTATGCTATTAAGAGAGTTT
ATGATGGATCCTGAATTATCATCATATTCTGTTGTTATGATTGATGAGGCACATGAAAGA
ACTTTACATACTGATATTTTGTTTGGATTAATCAAAGATCTTGCCCGTGCCCGAAACAAT
TTAAAAGTTATTATCTCATCAGCGACCATGGATGCTGAGAAATTTGCAAGATATTTTGAC
AATGCGCCTATATTTGGTATTCCAGGCCGTAGGTTCCCAGTGGATGTATTTTACACAAAA
AGTCCTGAAGCTGATTATATAGAAGCAGCAGTAATAACAGTCTTACAAATTCATGTAACC
CAGCCAGCAGGGGATATCCTAGTATTTCTTACAGGTCAAGAAGAAATTGAATCAACTCAC
GATATTTTATTAAGCCGAACACGAGGTTTAGGTACTAAAATCCCTGAATTAATAATATTG
CCAATATATTCAAATCTCCCAAGCGAAATGCAAGCTAAAATCTTTGAACCAACCCCAGAA
GGTGCTAGAAAAGTAGTCTTAGCAACCAATATAGCTGAAACAAGTGTAACTATAGATGGA
ATTATATACGTTATTGACTGTGGATTATGTAAAGAAACTTGTTATAATCCTCGAACAGGT
ATGGAAAGTCTAGTAATTGTCCCTATATCCAAAGCTTCAGCACGTCAAAGAGCTGGTAGA
GCAGGTCGTGTGGCTCCTGGTAAATGTTTTAGAATCTATACTTTATGGTCTTATGACAAT
GAACTTGAAGAAAACCCAGTCCCTGAAATCCAAAGGTGTAATCTTGGTAATGTTGTTTTA
ATACTCAAGTCTTTAGGTATAGAAGATCTTGTGCATTTTGATTTCTTAGATCCACCAGCA
AGTGAAACTCTTATTCGAGCTCTTGAAGAACTTTATGCTCTTGGGGCATTAAATGATGAA
GGACAATTAACTAAACTTGGCCGAAGAATGGCTGAGTTCCCTGTAGATCCAAAGCTTTCT
AAATGTATTATGTATTCTGAAAAATACTCTTGTACTAATGAAGTGGCTACTATTGCAGCT
ATGTTAAGTGTTGGGAATTCAGTGTTTTTTAGACCTAAAGATAAAATAATGCATGCTGAT
AATGCTAGAATGAGTTTTTCATGTAGAGATGGAGATCATTTAACTTTATTTAATGTTTAC
TCACAATGGGAAGAAGCTAATTTTTCAAGTATTTGGTGTAGAGATCATTTTATACAGTAT
AGGTCTATGAATAAAGCTAGGGATATTAAAGAACAACTTGTGGACTTGTGTGAAAGGGTT
GAGATTATTGTCAATAAAGAACCTTGTAAAGATATCAAAATGGTCATCAAGTCTTTTTGT
TCAGGGTATTTTTTCAATTGTGCTAGATTACATAAAAGCGGAATTTATAAGACAGTTAAA
AATGCTCATACTGTTTTTATACACCCAAGTTCTGTTATGTTTAAAGAAATGCCTAAATGG
GTTATGTACCATGAACTTGTTCTTACAAGTAAAGAGTTTATGCGTCATGCTAGTATTATG
AGTTCACAATGGCTTACTGAGCTTGCACCACATTATTTTAGTTCTCAAGATTTAGATGAT
GACTCAATCAAAAAAATGCCTAAACCTATAAAGTTAAATCCTTAA