Identifiers and Description

Gene Model Identifier

SteCoe_23189

Standard Name

None

Aliases

None

Description

AAA domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig21432.0.g83.4811068399043105e-57ATPase family associated with
various cellular activities (A
AA)

Tetrahymena ThermophilaTTHERM_002136004.1863939993042314e-51Subunit of Replication factor
C (RF-C), which acts as a clam
p loader of the proliferating
cell nuclear antigen (PCNA)
Saccharomyces CerevisiaeYNL290W6.213159586848109e-49Subunit of heteropentameric Re
plication factor C (RF-C); whi
ch is a DNA binding protein an
d ATPase that acts as a clamp
loader of the proliferating ce
ll nuclear antigen (PCNA) proc
essivity factor for DNA polyme
rases delta and epsilon; reloc
alizes to the cytosol in respo
nse to hypoxia
WormBaseWBGene000184091.368539471173853e-44

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23189(Protein)
MDIDEVIELPWVEKYRPSNLEDLVAHEAIISTIKKFIKEKKLPHLLFYGPPGTGKTSTIL
AVAKEMYGKSFSTMSLELNASDDRGINVVREQIKNFASTQQIMSKGIKLIILDEADSMTN
AAQFALRRIIEKYTKTTRFCMICNYVSKIIPALQSRCTRFRFMPLPPQIARERIRMISQC
EGLDITEDGINSLVELGNGDMRKYLNILQSTAMAFQHIDSQAVYACTGNPDPVFIDRVLE
ILLSLNFNEVFEELMKKKVDFGFSLCDILRELHKNLAQITFPEKMKMFLIKRMAEVEMRL
SQGANEKIQLGSLIGAFIEARNLNLL


>SteCoe_23189(CDS)
ATGGATATAGACGAAGTGATCGAGCTACCTTGGGTTGAAAAATACAGACCTAGTAATTTA
GAAGATTTAGTTGCCCATGAAGCTATTATATCAACAATCAAAAAATTCATTAAAGAAAAA
AAACTACCTCATCTTCTATTCTATGGTCCACCTGGTACTGGTAAAACATCAACAATTCTA
GCAGTAGCCAAAGAAATGTATGGGAAATCTTTTTCAACTATGAGTTTAGAACTTAACGCT
TCAGACGATCGTGGAATAAACGTAGTCAGAGAACAAATAAAAAACTTCGCCAGCACACAA
CAAATCATGTCTAAAGGTATAAAACTTATAATATTAGACGAAGCAGATTCAATGACAAAT
GCAGCTCAATTCGCATTAAGAAGGATTATAGAAAAGTACACAAAAACTACACGTTTTTGT
ATGATATGCAATTATGTATCTAAAATTATCCCAGCTCTACAATCAAGATGTACAAGATTT
AGATTTATGCCTTTACCTCCACAAATAGCTAGAGAGAGGATAAGAATGATATCACAATGT
GAAGGACTTGATATAACAGAAGATGGGATTAATTCTCTTGTAGAATTAGGTAATGGAGAT
ATGAGAAAGTATTTAAATATACTTCAAAGTACGGCTATGGCTTTTCAACATATAGATTCA
CAAGCTGTATATGCATGTACTGGTAATCCTGATCCTGTGTTTATTGATAGGGTGTTAGAA
ATTCTTTTATCATTAAATTTCAATGAAGTCTTTGAAGAACTCATGAAAAAAAAAGTTGAC
TTTGGGTTTTCGCTTTGTGATATACTTAGAGAATTACATAAGAACCTAGCGCAAATAACA
TTTCCTGAAAAAATGAAAATGTTTCTTATAAAACGCATGGCTGAAGTCGAAATGCGCCTT
TCTCAAGGAGCTAATGAGAAAATCCAACTTGGATCATTGATAGGAGCTTTTATAGAAGCA
CGTAATTTGAATTTACTATAA