Identifiers and Description

Gene Model Identifier

SteCoe_23192

Standard Name

None

Aliases

None

Description

Ribosomal_L13e domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig4065.0.1.g967.095474162284704e-23Ribosomal protein L13e

Tetrahymena ThermophilaTTHERM_005786405.74952226429356e-19Homolog of yeast RPL13/(RPL13e
)
WormBaseWBGene000044253.1391327920480296e-17
Saccharomyces CerevisiaeYDL082W6.305116760146989e-16Ribosomal 60S subunit protein
L13A; not essential for viabil
ity; homologous to mammalian r
ibosomal protein L13, no bacte
rial homolog; RPL13A has a par
alog, RPL13B, that arose from
the whole genome duplication

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23192(Protein)
MVKHNNVVPNGHFRKDWMHYVKTWFNQAGRKDRRRKARSLKASETAPNPLKALRPLVQGQ
TIRYCSTTKKGRGFSLQEIKKAGLTAQFARTIGIRVDHRRRNKSTETLERNVKELNFYKS
KLTLYPLKAGKPKKGQINDSLQS


>SteCoe_23192(CDS)
ATGGTTAAGCACAACAACGTGGTTCCAAATGGTCACTTTCGTAAAGACTGGATGCACTAC
GTTAAAACTTGGTTTAATCAGGCTGGCAGAAAAGACAGAAGAAGGAAAGCCCGGAGCTTG
AAAGCTTCAGAAACTGCGCCAAATCCTTTAAAGGCTTTAAGACCACTGGTCCAAGGGCAG
ACAATCAGATATTGCTCAACAACCAAAAAAGGACGAGGTTTTTCTCTTCAAGAAATCAAA
AAGGCTGGACTTACCGCACAATTTGCAAGAACTATTGGTATCAGAGTTGATCATAGAAGA
AGGAATAAGAGCACAGAAACTTTAGAGAGAAATGTAAAAGAGCTCAACTTTTACAAATCT
AAACTTACACTCTATCCTTTAAAGGCTGGAAAACCAAAAAAGGGACAAATTAATGACTCG
CTACAGAGTTAA