Identifiers and Description

Gene Model Identifier

SteCoe_23264

Standard Name

None

Aliases

None

Description

Ribosomal_S13_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYDR064W3.6251409191435593e-34Protein component of the small
(40S) ribosomal subunit; homo
logous to mammalian ribosomal
protein S13 and bacterial S15
Oxytricha TrifallaxContig5219.0.1.g443.6251409191435593e-34Ribosomal S13/S15 N-terminal d
omain

WormBaseWBGene000044825.380186160021138e-32
Tetrahymena ThermophilaTTHERM_007733301.462486227251231e-31Homolog of yeast RPS13, human
RPS13, bacterial RPS15;

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23264(Protein)
MGRMHSDGKGIAASALPYKRAPPTWLKVSGQEVSEHIVKLARKGLYPSQIGVILRDTAGI
PQVKSITGAKILRILKKNGIAPEIPEDLYNLIKKAVSVRKHLEKFRKDKDSKFRLILIES
RIHRLARYYKRTKKLPANWRYNSATASALVS


>SteCoe_23264(CDS)
ATGGGTCGTATGCACTCTGATGGCAAAGGAATTGCAGCTTCTGCTTTACCTTATAAGAGA
GCACCTCCAACCTGGCTTAAAGTATCAGGTCAAGAAGTTAGTGAGCATATAGTTAAATTA
GCTAGAAAAGGCTTGTATCCTTCACAAATTGGTGTTATACTAAGAGACACTGCAGGAATT
CCTCAAGTGAAGTCTATTACTGGGGCCAAAATTCTTAGGATATTGAAAAAGAATGGTATT
GCCCCTGAAATCCCAGAAGATCTCTACAATCTGATCAAGAAGGCTGTGTCAGTAAGAAAA
CACTTGGAAAAATTCAGGAAAGACAAGGATAGCAAGTTTAGACTTATTCTTATTGAATCA
AGGATTCATAGATTAGCGAGATACTACAAAAGAACAAAAAAACTTCCAGCAAACTGGAGA
TATAACTCAGCAACAGCTTCCGCTTTAGTAAGCTAA