Identifiers and Description

Gene Model Identifier

SteCoe_23547

Standard Name

None

Aliases

None

Description

HATPase_c_3 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig8643.0.g107.47197233734299e-43DNA mismatch repair protein, C
-terminal domain

Saccharomyces CerevisiaeYMR167W3.975449735908647e-31Protein required for mismatch
repair in mitosis and meiosis;
also required for crossing ov
er during meiosis; forms a com
plex with Pms1p and Msh2p-Msh3
p during mismatch repair; huma
n homolog is associated with h
ereditary non-polyposis colon
cancer
WormBaseWBGene000033738.75651076269652e-27
Tetrahymena ThermophilaTTHERM_001270002.3802664086944007e-26DNA mismatch repair protein, C
-terminal domain containing pr
otein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23547(Protein)
MARIQKLSNETINKIAAGEVVQKPSSALKELMENSIDAGSTSIVVKLKDGGMTLIQIIDN
GFGIYVDDLPILCHRYTTSKITAYEDLSRLTTFGFRGEALSSISQVAKLTVCSRRQGEAL
GYKAEYVCGDLLNPPCVYAYDKGTCITIEDLFYTNPCRKRALSDCSELFRNCWDLIAKYS
LHYPHISFKLFKGDSLELKTPGDGNQDEPLKSLLKNCNISREIIEIPTTKTEFCEYSGMI
SNSQYSLKLKLFVIFVNGRLVDSNDLKKLVNEIYGKFMPKSSSFFVYISIKVPSNEVDVN
VHPTKLEVRFSKESHIFAEITTRIQEVLSVSNDSRVLTIKSFEIPKPSLDKLAPLRQVRE
QPTVPLEWFVEPKPLHIPKQNDEDLASIHELKEEIQQGKYQEVLSKFYYVGCANKDYVLI
QYQTSLYLLSVSQLLQCYIYQDILNHFAQLPSFEIPNLTLSISQILDLALSSPHLGYNPN
TDPPASQLIDNYTKFLEQKANLLEDYFSFSIKDRVIRKIPVVCDGLVVPDINNLPEFLLR
LCTDVNWKNEKKCLGKISELLAWFYSKVPDTWTVGETTENFEVHYKNLLFPYLRGRVVAD
YRKIDEGFIHIVSTEDLYKIFERC


>SteCoe_23547(CDS)
ATGGCGCGAATACAAAAGCTCAGTAACGAGACCATCAACAAAATCGCTGCTGGTGAAGTT
GTCCAAAAGCCAAGTTCCGCTCTAAAAGAGCTTATGGAAAACAGTATCGATGCTGGTAGT
ACATCAATTGTAGTAAAACTAAAAGATGGAGGAATGACTCTGATACAGATAATTGATAAT
GGTTTTGGTATCTACGTTGATGATTTACCTATTCTTTGTCATAGATATACAACTTCTAAA
ATAACAGCTTATGAAGATCTTTCAAGGCTTACTACATTTGGCTTTAGAGGTGAAGCTTTG
AGTAGTATTTCACAAGTCGCTAAGCTAACTGTATGTAGCCGTCGTCAAGGAGAGGCTTTA
GGTTATAAAGCTGAATATGTTTGTGGGGATCTTTTAAATCCTCCTTGTGTTTATGCATAT
GATAAAGGCACTTGTATAACAATTGAAGATCTTTTCTATACAAATCCTTGTCGTAAAAGA
GCCTTATCTGATTGTTCTGAACTTTTTAGAAATTGTTGGGACCTCATAGCAAAATATTCA
CTTCATTATCCACATATTTCCTTTAAACTCTTCAAAGGAGACTCTTTAGAATTAAAAACT
CCAGGTGATGGGAATCAAGATGAACCTTTAAAATCTTTACTTAAAAACTGTAACATATCA
AGGGAAATCATAGAAATACCTACAACAAAAACTGAATTTTGTGAGTATTCAGGGATGATA
TCAAATTCCCAATATTCTTTAAAATTAAAACTTTTTGTGATTTTTGTTAATGGTCGACTT
GTTGACTCTAATGATCTGAAAAAACTTGTTAATGAAATATATGGGAAATTTATGCCTAAA
TCAAGTAGTTTCTTTGTTTATATTTCTATAAAAGTTCCTTCAAATGAAGTTGATGTTAAT
GTTCACCCTACTAAGCTAGAAGTAAGATTTTCTAAAGAAAGCCATATTTTTGCTGAGATT
ACTACAAGAATTCAAGAGGTTTTAAGTGTGAGTAATGACTCTAGGGTTTTAACTATAAAA
AGTTTTGAAATACCAAAACCTAGCTTAGACAAACTTGCTCCTTTAAGACAAGTTCGAGAA
CAACCAACAGTACCTTTAGAATGGTTTGTTGAACCTAAACCTTTACATATACCTAAACAA
AATGATGAAGACCTAGCTAGTATACATGAACTAAAAGAAGAAATTCAACAAGGGAAATAT
CAGGAAGTTCTTAGCAAATTCTATTATGTCGGCTGTGCAAATAAAGATTATGTTCTTATT
CAATATCAAACTTCATTATATTTACTATCAGTTTCTCAATTACTTCAATGCTATATTTAT
CAAGATATACTTAATCACTTTGCCCAATTACCATCTTTTGAAATCCCTAATTTAACTTTA
TCTATATCACAAATATTAGATTTAGCTTTATCATCACCTCATCTTGGGTATAATCCAAAT
ACAGATCCTCCTGCAAGTCAATTGATTGATAATTATACTAAGTTTTTAGAACAAAAAGCT
AACCTTTTAGAAGACTATTTTTCTTTTAGTATCAAAGATAGGGTTATTAGGAAAATACCT
GTGGTTTGTGATGGTCTTGTTGTTCCTGATATAAATAATTTACCAGAGTTTTTATTAAGG
CTCTGTACGGATGTCAATTGGAAAAATGAAAAAAAATGTTTGGGGAAAATTTCTGAATTG
CTAGCATGGTTCTATTCAAAAGTTCCAGATACATGGACTGTTGGTGAGACTACAGAAAAT
TTTGAAGTTCATTATAAAAATTTACTCTTTCCTTATTTAAGAGGTAGAGTTGTAGCTGAT
TATAGGAAAATTGATGAAGGTTTTATTCACATAGTTAGCACTGAGGATTTGTATAAGATT
TTCGAAAGGTGTTAG