Identifiers and Description

Gene Model Identifier

SteCoe_23557

Standard Name

None

Aliases

None

Description

FOP_dimer domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000030470
Tetrahymena ThermophilaTTHERM_005297705.74952226429356e-19hypothetical protein
Oxytricha TrifallaxContig20161.0.g731.1548224173015786e-17FOP N terminal dimerisation do
main

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23557(Protein)
MATMEDLKTALKETLFKRGVLGDIKAKIRAEIFAALDDQDVNRPRLNDENLLINELIREY
LQYNNYHHALSVFLAESGQPAQPVMERVHMARELRVSEDAKSRSVPLMYGLVRGIRPTLA
EPLKPDPQPIPKRGDLFSQEPEPFEFTKF


>SteCoe_23557(CDS)
ATGGCTACAATGGAAGATTTAAAAACAGCACTCAAAGAAACCCTGTTTAAGCGCGGGGTT
CTAGGAGATATCAAAGCGAAAATCAGAGCTGAAATTTTTGCAGCGCTGGACGACCAGGAT
GTAAATCGTCCAAGACTTAACGATGAAAATCTTTTAATAAACGAACTTATAAGAGAATAT
TTGCAATACAACAATTATCATCATGCTTTAAGTGTATTTTTAGCAGAATCTGGCCAACCT
GCACAGCCTGTTATGGAAAGAGTCCATATGGCTCGTGAATTACGTGTTTCAGAAGATGCG
AAAAGTCGCAGTGTACCTTTGATGTATGGACTTGTTAGAGGAATTAGACCAACTCTTGCT
GAACCTCTTAAACCTGACCCACAACCAATACCTAAAAGAGGAGATTTATTTTCACAGGAA
CCTGAGCCTTTTGAGTTTACTAAGTTTTAA