Identifiers and Description

Gene Model Identifier

SteCoe_23573

Standard Name

None

Aliases

None

Description

Aconitase domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig8489.0.g830Aconitase family (aconitate hy
dratase)

WormBaseWBGene000000400
Saccharomyces CerevisiaeYLR304C3.221340285992516e-27Aconitase; required for the tr
icarboxylic acid (TCA) cycle a
nd also independently required
for mitochondrial genome main
tenance; phosphorylated; compo
nent of the mitochondrial nucl
eoid; mutation leads to glutam
ate auxotrophy

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23573(Protein)
MAGTNPFDARCLKDLQVGEKTYKFYNVQGLNDPRLSRLPYSIRILLESAIRNCDEFEVKS
SDVENILNWEQTSKQDIEIPFKPARVLLQDFTGVPAVVDLAAMRDAFVKIGGTPSRINPL
CPVDLVIDHSIQVDVARSLEALQQNEEFEFFRNRERFEFLKWGQKAFENLLIIPPGSGIV
HQVNLEYLARIIFDRNGLLYPDSVVGTDSHTTMINGAGVVGWGVGGIEAEAVMLGQSISM
VLPEVVGFKLTGKLSDAATATDLVLTVTKMLRQRGVVNKFVEFFGSGVENLSIADRATIG
NMAPEYGATVGYFPMDGKTLDFLKTSGRSSEKIAFIEAYLKANGLFRDYNGEDPVFSGAV
LELDLGAVVPCVAGPKRPHDRVSVSDLKNEFITGLTGPVNFKGFGVPNPEAVSTFDYKGQ
TFNLKHGSVVIAAITSCTNTSNPGVMLAAGLLAKNAIAKGLRVAPYIKTSLSPGSGVVTK
YFDKAGVTEFLNELGFTVAGYGCMTCIGNSGDLEEEVLKAISANDLVATSVLSGNRNFEG
RVHPATRANYLASPPLVVAYALAGRVDFDFETEPLGVFEGNPVFLRDIWPSRELVNQTVN
EIITPEMFAEVYNRIAQGTDRWNSLEAAEGTLYSWKDESTYIHNPPFFKSLTLEIPPIRD
ITNAYALLKLGDSITTDHISPAGNIARNSPAAKYLQVRGVPPKEFNSYGARRGNDEIMMR
GTFANIRLVNTLINHAGPQTKHVPSGEEMDIYEASARYQQDGVDLIVIAGKEYGSGSSRD
WAAKGPYLLGVKAVIAESYERIHRSNLLGMGILPLQFLPDQNAASLELTGFEKFNIVLNG
HVGVQQIIEVVTDSGKTFNVKARVDTDVEVEYFRHRGILHYVLRKLAKNN


>SteCoe_23573(CDS)
ATGGCAGGAACTAATCCGTTTGATGCTCGATGCTTAAAAGATCTCCAGGTAGGCGAGAAA
ACCTACAAATTTTACAATGTCCAAGGTCTAAATGACCCACGACTCTCCAGATTGCCTTAT
TCCATTAGAATCCTCCTTGAAAGTGCTATAAGAAACTGCGACGAATTCGAAGTCAAGTCT
TCTGATGTGGAAAACATCCTCAATTGGGAGCAGACTTCAAAACAAGATATCGAAATCCCA
TTCAAACCAGCCAGAGTTCTTTTACAAGATTTTACAGGTGTTCCAGCTGTAGTCGACCTA
GCAGCAATGAGAGATGCTTTTGTCAAAATCGGAGGAACTCCATCACGTATAAACCCATTA
TGCCCAGTAGATTTAGTAATTGACCATTCAATTCAAGTTGATGTCGCAAGATCACTTGAA
GCTTTGCAACAAAATGAAGAATTCGAATTCTTTAGGAACAGAGAAAGGTTTGAGTTCTTG
AAATGGGGCCAAAAAGCTTTTGAGAATTTGCTTATTATCCCTCCAGGCTCAGGGATTGTT
CATCAAGTTAATCTTGAGTACCTGGCTAGGATTATTTTTGATAGAAATGGCCTTTTATAC
CCTGATTCAGTTGTCGGAACTGACTCACATACGACTATGATTAATGGAGCTGGTGTTGTT
GGATGGGGTGTTGGGGGTATTGAAGCTGAAGCAGTTATGTTGGGACAATCAATTTCTATG
GTTTTACCTGAAGTTGTTGGGTTTAAACTTACTGGGAAGCTTTCTGATGCAGCTACAGCT
ACAGATTTGGTATTGACAGTGACTAAAATGCTTAGACAAAGAGGAGTTGTTAATAAATTT
GTTGAGTTCTTTGGATCTGGTGTTGAAAATTTGTCTATTGCAGATAGGGCGACTATTGGT
AACATGGCTCCTGAATATGGTGCAACAGTAGGTTACTTCCCTATGGATGGGAAAACCTTA
GACTTCTTGAAAACCTCAGGCAGGTCAAGTGAAAAAATCGCTTTTATTGAAGCTTATCTT
AAAGCTAATGGGCTTTTCAGAGATTATAACGGAGAAGATCCTGTTTTCTCAGGAGCTGTA
CTTGAACTTGATTTAGGTGCTGTTGTTCCTTGTGTAGCAGGACCCAAACGTCCTCATGAC
AGAGTTTCTGTATCAGATTTAAAGAATGAATTCATCACAGGACTTACAGGCCCAGTGAAT
TTTAAAGGCTTTGGTGTTCCTAACCCTGAAGCTGTGAGCACTTTTGACTATAAAGGCCAG
ACTTTCAATCTTAAGCATGGTTCTGTCGTTATAGCCGCTATAACTTCTTGTACCAACACC
TCCAATCCTGGTGTTATGTTGGCTGCAGGGCTTTTAGCTAAAAATGCTATAGCTAAAGGA
CTAAGAGTTGCTCCTTATATTAAAACATCATTATCCCCAGGTTCAGGTGTTGTAACTAAA
TACTTTGATAAAGCAGGTGTCACTGAATTCTTAAATGAACTTGGCTTTACTGTTGCTGGA
TATGGCTGTATGACTTGTATTGGTAATTCTGGAGATTTAGAAGAAGAAGTTCTAAAGGCA
ATCAGTGCTAATGATCTTGTAGCTACATCTGTACTATCAGGAAATAGGAACTTTGAAGGT
CGTGTGCATCCAGCTACAAGAGCGAATTATCTAGCAAGTCCTCCTTTGGTTGTAGCTTAT
GCCCTAGCTGGCCGTGTGGACTTTGACTTCGAAACTGAGCCTCTAGGAGTTTTTGAAGGT
AACCCTGTGTTCTTAAGAGATATCTGGCCATCAAGAGAGCTTGTCAATCAGACTGTTAAC
GAGATTATTACTCCAGAAATGTTCGCTGAGGTCTATAATCGCATCGCTCAAGGTACAGAC
AGATGGAACTCTCTTGAAGCAGCTGAAGGAACTCTATATTCTTGGAAAGATGAGTCAACT
TATATCCACAACCCACCATTTTTCAAGTCCTTAACCTTAGAAATTCCCCCAATTAGAGAT
ATCACAAATGCTTATGCCTTGCTTAAACTTGGAGACTCCATAACAACTGATCATATTTCT
CCAGCAGGGAATATTGCCAGGAACTCCCCAGCAGCCAAGTATTTGCAAGTTCGTGGGGTA
CCTCCTAAAGAATTTAACTCTTATGGAGCTCGTAGAGGTAATGATGAAATCATGATGAGA
GGAACTTTTGCAAACATTCGCCTTGTAAATACTCTTATAAATCATGCTGGTCCACAGACA
AAACATGTGCCAAGTGGTGAAGAGATGGATATTTATGAAGCTAGTGCGAGATATCAGCAG
GATGGAGTTGATCTGATTGTTATTGCTGGTAAAGAATATGGGTCTGGGTCATCTAGAGAC
TGGGCAGCTAAAGGTCCTTATCTACTTGGCGTCAAAGCAGTAATTGCAGAAAGTTATGAG
AGGATTCATAGATCTAACTTACTTGGTATGGGGATTTTACCTTTACAGTTCTTGCCTGAT
CAAAATGCTGCTTCACTTGAACTTACTGGGTTTGAGAAGTTTAACATTGTTTTGAATGGA
CATGTTGGAGTACAGCAGATTATTGAAGTAGTCACAGATAGTGGAAAAACTTTTAATGTT
AAGGCCAGAGTGGATACTGATGTTGAAGTTGAATACTTTAGACATAGAGGAATTTTGCAT
TACGTACTTAGGAAATTAGCTAAGAATAACTAA