Identifiers and Description

Gene Model Identifier

SteCoe_23725

Standard Name

None

Aliases

None

Description

PTS_2-RNA domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • transferase activity, transferring phosphorus-containing groups (IEA) | GO:0016772

Biological Process

  • tRNA splicing, via endonucleolytic cleavage and ligation (IEA) | GO:0006388

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig3963.0.g426.054601895401186e-39RNA 2'-phosphotransferase, Tpt
1 / KptA family

Tetrahymena ThermophilaTTHERM_008542801.2995814250075031e-24RNA 2'-phosphotransferase, Tpt
1 / KptA family protein
WormBaseWBGene000198255.242885663363464e-22

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23725(Protein)
MKKRQPQINYIKVSKKLSWALRHGIGELGLSINAAGYVNLQELLSKREFSSVTPEIITTL
VANDEKTRFSLLQENGITFIRANQGHTISQVKDEELLTPILNPNDYPIVVHGTNKASWKS
IKTRGLYKMQRNHIHFARGLPGDNQVISGARVNCEVFIFIDLPLAISEGMKFYVSENQVI
LSSGFGGFISPKYFSKVIINKISVPIDYKPIDFDYFLILDFEANCIENGTLPCQEIIEFP
VKVLNAQTFNVEYIFHSYIQPDIVPNITDFCTNLTGITQDMVNGQYKLPEVLQNFHNFLV
TNNIIQTRWIFVTCGDWDLKTCLRNEAQYKKLPINNYFNAWINIKFLIPKFKGGMMELLS
LFSIPHSGKHHSGIDDVTNITECLKYLLHNKVGICFEDIRMNTAQMALDNVPFRHNKVF


>SteCoe_23725(CDS)
ATGAAAAAAAGGCAGCCTCAAATAAACTATATCAAAGTCTCTAAAAAACTATCATGGGCA
CTTCGACATGGTATAGGCGAGCTTGGTTTATCAATCAACGCTGCTGGTTACGTGAATCTC
CAAGAACTTCTTTCCAAACGAGAATTCTCATCAGTAACCCCAGAAATCATTACAACCCTA
GTAGCCAATGATGAAAAAACCCGTTTTTCTTTATTACAAGAAAACGGAATTACTTTTATT
AGAGCCAATCAGGGTCATACAATTTCTCAAGTCAAAGATGAGGAACTTCTAACACCAATC
CTAAACCCAAATGACTATCCAATTGTCGTACATGGAACTAACAAAGCATCATGGAAGTCA
ATAAAAACCCGAGGTCTATACAAAATGCAAAGAAATCACATACATTTTGCTAGAGGACTT
CCTGGAGATAATCAAGTAATAAGTGGAGCTCGAGTTAATTGTGAAGTGTTTATTTTTATT
GATTTACCTTTAGCTATATCTGAAGGGATGAAATTTTATGTATCAGAAAATCAAGTTATA
TTAAGCTCAGGCTTTGGGGGGTTCATATCTCCAAAGTATTTTTCAAAGGTCATTATAAAT
AAAATTTCAGTGCCAATTGATTATAAACCTATAGATTTTGATTATTTCCTAATATTAGAC
TTTGAAGCAAATTGTATAGAAAATGGGACTTTACCTTGTCAAGAAATCATCGAGTTTCCA
GTCAAAGTTCTTAATGCCCAAACATTTAATGTTGAGTATATCTTCCATAGTTATATTCAA
CCTGATATTGTCCCTAATATTACAGATTTCTGCACAAATCTTACTGGTATAACACAAGAT
ATGGTTAATGGTCAATACAAATTACCTGAAGTATTACAAAACTTCCATAATTTCTTAGTG
ACAAATAATATTATCCAAACTAGATGGATTTTTGTTACTTGTGGTGACTGGGATTTAAAA
ACATGTTTGAGAAATGAAGCTCAATATAAAAAACTCCCTATAAACAACTATTTTAATGCT
TGGATCAATATAAAATTCCTTATCCCTAAATTTAAAGGTGGCATGATGGAGTTATTATCG
TTATTTTCAATACCACATAGTGGGAAACATCATTCTGGGATTGATGATGTGACGAATATT
ACTGAATGTCTTAAGTATCTTTTGCATAATAAGGTTGGAATATGTTTTGAAGATATAAGG
ATGAATACTGCACAGATGGCTTTAGATAATGTTCCGTTTAGACATAATAAGGTTTTTTAG