Identifiers and Description

Gene Model Identifier

SteCoe_23772

Standard Name

None

Aliases

None

Description

Ribosomal_S11 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007653007.984904245686979e-30Homolog of yeast RPS14, human
RPS14, bacterial RPS11
WormBaseWBGene000044832.1705220113036395e-29
Saccharomyces CerevisiaeYCR031C8.75651076269652e-27Protein component of the small
(40S) ribosomal subunit; requ
ired for ribosome assembly and
20S pre-rRNA processing; muta
tions confer cryptopleurine re
sistance; homologous to mammal
ian ribosomal protein S14 and
bacterial S11; RPS14A has a pa
ralog, RPS14B, that arose from
the whole genome duplication
Oxytricha TrifallaxContig8934.0.g1065.242885663363464e-22Brix domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23772(Protein)
MSKAKGKKQEKVQEEPEQAILGANPTGEKIFAVCHLYASFNDTFIHVTDLSGRETLTRVT
GGMMVKADREESSPYAAMMAAVEVSNRLKKLGINALHIKIRAKGGADSKTPGPGAQAALR
ALARNGMKIGRIEDVTPIPTDSTRREGGRRGRRL


>SteCoe_23772(CDS)
ATGTCTAAGGCCAAGGGAAAGAAGCAAGAAAAAGTCCAAGAAGAGCCTGAACAAGCAATT
CTAGGAGCCAACCCAACAGGAGAGAAAATATTTGCAGTTTGTCATCTCTACGCATCTTTC
AATGACACCTTTATTCATGTTACTGACTTATCTGGAAGGGAAACTTTAACAAGAGTCACT
GGAGGAATGATGGTTAAGGCTGACCGTGAAGAAAGTTCTCCTTATGCAGCTATGATGGCA
GCTGTTGAAGTTAGCAATAGGCTTAAAAAACTAGGGATTAATGCCTTGCATATTAAAATC
AGAGCTAAAGGAGGAGCTGATAGTAAAACTCCTGGCCCTGGAGCTCAGGCTGCATTGAGA
GCACTTGCTAGAAATGGAATGAAGATTGGGAGAATTGAAGATGTTACACCAATACCAACA
GATAGCACAAGAAGAGAAGGAGGGAGAAGAGGTCGTAGACTATAA