Identifiers and Description

Gene Model Identifier

SteCoe_23788

Standard Name

None

Aliases

None

Description

CAF1C_H4-bd domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000030362.2856936767186716e-49
Oxytricha TrifallaxContig12239.0.g711.6889118802245324e-48WD domain, G-beta repeat

Tetrahymena ThermophilaTTHERM_006886603.720075976020836e-44hypothetical protein
Saccharomyces CerevisiaeYEL056W1.2995814250075031e-24Subunit of the Hat1p-Hat2p his
tone acetyltransferase complex
; required for high affinity b
inding of the complex to free
histone H4, thereby enhancing
Hat1p activity; similar to hum
an RbAp46 and 48; has a role i
n telomeric silencing

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23788(Protein)
MKDEQDCAEEAEDQLINEKYRAWRKSSPILYDLLICKSLEWPSLTIEWLPSKETFSDYSI
QKILIGTHTNTPNTNYLQLLSIILPLEDSLLNKSTCDALLSNRNKITSSLILPHECDINT
ARCMPQKDQIIASKGTSGLVYIYDCEKFKDNPQESPLILTGHQKEGLNLSWSPIKEGFLA
SGSDDHLVCVWDLNTMKNPTVLNHHTSIVEDVSWSEFYINALASVGDDRKIILWDLRQNT
PSHVIEAHIHEINSIDFNKHDEFLLATGSNDKTIAIWDMRNMGRKLVSLEYHQDTVHKVS
WAPFSMSIIASISNDKKVVIWDLGRINSENLDELPSEVLFTHNGHTGRISDFSWNLNDHF
LMNSVSEDNMLHVWQMSHTLFTTESVRLGVPDKDIPLNSD


>SteCoe_23788(CDS)
ATGAAAGACGAACAAGACTGCGCAGAAGAAGCTGAGGACCAATTAATAAACGAAAAATAC
CGTGCTTGGAGAAAATCCAGTCCAATCCTCTACGACCTTCTCATATGTAAATCCTTAGAA
TGGCCATCTCTAACAATTGAATGGTTACCTTCTAAAGAAACCTTCTCAGACTATTCTATT
CAAAAAATCCTCATTGGTACTCATACAAACACGCCAAATACAAACTACCTTCAATTATTA
TCAATAATCCTTCCACTAGAAGACTCTTTATTAAACAAATCAACATGTGATGCCCTTCTA
TCAAATCGTAATAAAATCACATCATCTCTTATACTTCCTCATGAATGCGATATAAACACA
GCTCGTTGTATGCCACAAAAAGATCAAATAATAGCATCTAAAGGTACATCTGGTTTAGTT
TATATCTATGACTGTGAAAAATTTAAAGATAATCCTCAAGAATCTCCATTAATTCTTACA
GGACATCAAAAAGAAGGGTTGAATTTATCATGGAGTCCAATAAAAGAAGGTTTTTTAGCT
AGTGGTTCAGATGATCATTTAGTATGTGTTTGGGATTTAAATACTATGAAAAACCCAACA
GTATTAAATCATCATACAAGTATTGTTGAAGATGTGTCATGGAGTGAATTTTATATAAAT
GCTTTAGCATCTGTAGGGGATGATAGGAAAATTATATTATGGGATCTTCGTCAAAATACC
CCAAGTCATGTTATTGAAGCGCATATTCATGAGATAAACTCAATTGATTTTAATAAACAT
GATGAGTTTTTATTGGCAACTGGATCTAATGATAAGACTATTGCTATATGGGATATGAGG
AATATGGGAAGAAAATTAGTTAGTTTGGAATATCATCAAGATACTGTTCATAAAGTTAGC
TGGGCACCTTTTAGTATGAGTATTATTGCTAGTATTAGTAATGATAAAAAAGTTGTCATT
TGGGACTTAGGGAGAATTAATTCTGAGAATTTGGATGAACTACCATCAGAAGTACTTTTT
ACTCATAATGGACATACAGGAAGGATTAGTGACTTTTCATGGAATTTAAATGACCACTTT
TTAATGAATTCAGTATCGGAAGATAATATGCTGCATGTTTGGCAAATGTCGCATACATTG
TTTACTACTGAGTCAGTACGTTTAGGGGTTCCAGATAAAGATATACCATTAAACAGTGAT
TAG