Identifiers and Description

Gene Model Identifier

SteCoe_23866

Standard Name

None

Aliases

None

Description

hypothetical protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007907305.242885663363464e-22Myb-like DNA-binding domain co
ntaining protein
Oxytricha TrifallaxContig22251.0.g512.8625185805493937e-20Myb-like DNA-binding domain

Saccharomyces CerevisiaeYDR448W1.1548224173015786e-17Transcription coactivator; com
ponent of the ADA and SAGA tra
nscriptional adaptor/HAT (hist
one acetyltransferase) complex
es

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23866(Protein)
MEGSEQSYKSILKKLKRKGGLKQISCEFCLKDITRCTYIQCSECSNLFYCIPCFAYAKSK
PDHLTSHKYFVIDPVKFPLFVHDWSGKDEVMLLQGLLKFGYGNWGCISEHLGSKKSAWEC
EKHYKLIYLRYAMNQLRNFPVLSCRNDQGFVITSDQENLELKASMEIEEQPVPQPEKRPE
IEKHPLSEFAGYMPLRRDFEIEYENDIEMYLADLEFYDDDKTEDTEIKLKQLEVYNKVLD
EREERKNFVIDRWPLELANEKKYKNNIIEKTIYQALKPYARLMPPEKHQTLFEGLVKEYV
LKLKLEELKEAQSRGIKTEDEFKKFLNEKKNTFSSKSEEYDNVTREPFILINNTKS


>SteCoe_23866(CDS)
ATGGAAGGATCTGAACAAAGTTATAAATCAATACTTAAAAAACTTAAACGCAAGGGAGGA
CTAAAGCAGATTTCTTGTGAGTTCTGTTTGAAAGATATTACAAGGTGTACTTATATCCAA
TGCAGTGAATGCTCTAACCTTTTCTATTGTATACCGTGTTTTGCCTATGCAAAAAGCAAG
CCTGACCACTTGACTTCACATAAATACTTTGTTATAGACCCAGTGAAATTCCCTTTGTTT
GTCCATGACTGGTCAGGTAAAGATGAGGTTATGCTATTACAAGGTTTGTTGAAATTCGGC
TACGGAAACTGGGGTTGTATAAGCGAACACCTAGGGTCTAAAAAATCAGCCTGGGAATGT
GAAAAACACTATAAACTCATATACCTCCGTTATGCCATGAATCAGTTAAGGAATTTTCCA
GTCCTCTCGTGCAGAAATGATCAAGGGTTTGTCATTACTTCAGACCAAGAAAACCTTGAA
CTTAAAGCAAGTATGGAAATAGAAGAACAACCTGTCCCACAACCTGAAAAAAGACCAGAA
ATCGAAAAACACCCTTTAAGCGAATTTGCTGGGTACATGCCTTTGAGAAGAGATTTTGAA
ATCGAATATGAAAATGATATCGAAATGTACTTGGCTGATTTAGAGTTTTATGATGATGAT
AAAACAGAAGATACAGAAATCAAGCTTAAACAATTAGAAGTGTATAATAAGGTCTTAGAT
GAAAGAGAAGAGAGGAAGAATTTTGTTATTGATCGATGGCCTTTAGAACTGGCGAATGAG
AAAAAGTATAAGAATAATATTATAGAAAAGACAATTTATCAAGCTTTGAAACCATATGCT
AGACTAATGCCCCCTGAGAAACATCAAACATTGTTTGAAGGGCTGGTTAAAGAGTATGTT
TTGAAGCTTAAACTTGAGGAACTTAAGGAAGCACAGAGTAGGGGGATTAAGACAGAGGAT
GAGTTTAAAAAGTTCCTTAATGAAAAAAAGAACACTTTTTCGTCTAAAAGCGAAGAGTAT
GATAATGTCACGAGAGAACCATTTATATTGATCAATAACACTAAAAGCTAG