Identifiers and Description

Gene Model Identifier

SteCoe_23877

Standard Name

None

Aliases

None

Description

Proteasome_A_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603
  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYGR135W8.194012623990515e-40Alpha 3 subunit of the 20S pro
teasome; the only nonessential
20S subunit; may be replaced
by the alpha 4 subunit (Pre6p)
under stress conditions to cr
eate a more active proteasomal
isoform
Tetrahymena ThermophilaTTHERM_010506901.6458114310822737e-3820S proteasome core alpha subu
nit 2
Oxytricha TrifallaxContig21162.0.g424.4737793061811207e-38Proteasome subunit

WormBaseWBGene000039241.2160992992528256e-37

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23877(Protein)
MSRRYDSKTTTFNPQGRLMQVEYAMEAINNAGSTVGVLCNEGIVIGAERKQTSKLLERAK
YSEKMYQIDAHIVCAAAGLTADANILINYARNMCQNYQFSYHQQIPVEQLVRQLCNAKQG
YTQHGGLRPFGVSFLYAGWDPIYGSQLYCSDPSGNYLGWKAIAIGANNQSASGILKQDYD
ENCTLRQALGLVAKVICKSMDTTTPTPDKIELITVTKGDKGVNYKALSDDEVQALLTEFN
LVNQ


>SteCoe_23877(CDS)
ATGTCACGGAGGTACGACTCAAAGACCACAACTTTCAACCCTCAAGGCCGTCTTATGCAA
GTAGAATACGCAATGGAAGCCATCAACAATGCAGGGTCAACAGTTGGAGTCCTATGCAAC
GAAGGTATCGTCATTGGAGCCGAACGCAAGCAGACTTCAAAACTCTTAGAAAGGGCCAAA
TACTCAGAAAAAATGTATCAAATCGATGCTCACATAGTCTGCGCAGCAGCTGGACTTACA
GCAGATGCAAACATTCTCATCAACTATGCTAGAAACATGTGTCAAAATTACCAATTTTCA
TATCATCAGCAAATCCCCGTAGAACAACTTGTAAGACAATTATGCAATGCTAAACAAGGT
TATACTCAACATGGAGGTTTAAGACCTTTTGGAGTATCCTTTTTATATGCTGGTTGGGAT
CCTATTTATGGATCTCAGCTTTATTGTTCAGACCCAAGTGGTAATTATCTTGGTTGGAAA
GCTATTGCTATTGGGGCTAATAATCAATCAGCTAGTGGGATACTTAAACAAGATTATGAT
GAGAATTGTACTTTGAGACAAGCTTTAGGACTAGTGGCTAAGGTTATATGTAAATCTATG
GATACAACAACCCCAACACCAGATAAAATTGAATTGATTACTGTGACAAAAGGAGACAAG
GGTGTTAATTATAAGGCTTTAAGTGATGATGAGGTACAAGCATTGCTTACAGAGTTCAAT
TTAGTTAACCAGTAG