Identifiers and Description

Gene Model Identifier

SteCoe_23989

Standard Name

None

Aliases

None

Description

Ldh_1_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (IEA) | GO:0016616
  • oxidoreductase activity (IEA) | GO:0016491

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_000522607.868448159078602e-63Malate dehydrogenase, cytoplas
mic, putative
Oxytricha TrifallaxContig10720.0.g161.1379798735078682e-50lactate/malate dehydrogenase,
NAD binding domain

WormBaseWBGene000184912.2856936767186716e-49

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_23989(Protein)
MSAVKVGVTGAAGQIGYSILPMICSGQMLGADTKIDLALLDIPQCEDALRGVAMEINDSA
FPLLNSLKYGSDPREILRDLDIIIFLGGFPRKAGMERKELLQKNMNIFKEQGTALNEVGK
PTTLCLVVANPANTNCLVLAHHAPNIPRKNFTAMTRLDHNRASFQIANRVGALTIDVKNV
AIWGNHSSTQYPDVNHGTVRGGAIRPAVNDDEWLNGEFISCVQKRGAAIIAARKLSSAMS
AAKAAVDHVRDWYLGTKDGEWVSMAVLSDGSYGIDTGLCYSFPCTCSNREWHIVQGLDIN
EFSRDKMNLTKQELTEERDEAFSA


>SteCoe_23989(CDS)
ATGTCAGCCGTCAAGGTCGGAGTAACAGGTGCAGCCGGACAAATCGGGTACTCAATCCTA
CCAATGATCTGCTCAGGTCAAATGCTAGGTGCAGATACCAAAATTGACCTCGCTCTTCTC
GATATCCCTCAATGTGAAGATGCCCTTCGCGGTGTGGCAATGGAAATCAATGATTCAGCT
TTCCCACTTCTCAACTCTCTAAAATACGGTAGCGACCCTCGTGAAATTCTCAGAGATCTC
GACATCATTATTTTCCTTGGAGGATTCCCACGTAAAGCAGGAATGGAACGTAAAGAACTT
CTTCAAAAAAACATGAACATCTTTAAAGAACAAGGAACTGCTCTTAATGAAGTTGGAAAA
CCTACAACTCTTTGTTTAGTAGTCGCTAATCCTGCAAATACAAATTGTTTAGTTTTAGCT
CATCATGCTCCTAATATCCCAAGGAAAAACTTTACTGCTATGACAAGACTTGATCATAAT
CGTGCTAGTTTCCAAATCGCAAACAGAGTTGGAGCATTAACTATTGATGTTAAAAATGTT
GCAATTTGGGGTAATCATTCCTCAACTCAATATCCTGATGTAAATCATGGTACTGTTAGA
GGTGGGGCAATTAGACCTGCAGTAAATGATGATGAATGGCTTAATGGAGAATTTATTTCA
TGTGTTCAGAAAAGAGGTGCTGCAATTATTGCTGCTAGAAAACTTTCTAGTGCTATGTCT
GCTGCTAAAGCTGCTGTTGATCATGTTAGAGATTGGTATCTTGGGACTAAAGATGGAGAA
TGGGTTTCTATGGCTGTACTTAGTGATGGTAGCTATGGTATTGATACTGGATTATGCTAC
TCATTCCCTTGTACTTGTTCTAATCGTGAATGGCATATTGTTCAAGGATTAGATATCAAT
GAATTCTCAAGAGATAAAATGAACCTAACAAAACAAGAACTTACTGAAGAAAGAGATGAA
GCCTTTTCAGCTTAA