Identifiers and Description

Gene Model Identifier

SteCoe_24084

Standard Name

None

Aliases

None

Description

STE11 family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_001933903.0144087850653746e-40Protein kinase domain containi
ng protein. Sequence similarit
y to the STE11 protein kinase
family (Eisen et al., 2006)."
Oxytricha TrifallaxContig11718.0.g181.462486227251231e-31Protein kinase domain

Saccharomyces CerevisiaeYJL095W1.2995814250075031e-24MAPKKK acting in the protein k
inase C signaling pathway; the
kinase C signaling pathway co
ntrols cell integrity; upon ac
tivation by Pkc1p phosphorylat
es downstream kinases Mkk1p an
d Mkk2p; MAPKKK is an acronym
for mitogen-activated protein
(MAP) kinase kinase kinase
WormBaseWBGene000015261.5628821893349888e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_24084(Protein)
MDSNCIKIKIKKATATPPDVSLDNLSDSAHNMTRTIGRDLFFASLSENPRKSLELEQKHF
DVQMEKKIGQGTYGSVYRAILKENGEFVAVKIFKIEISRDNWRAKVEVLDKEISILRRFE
NYNIVKYLGSEKLLNNKNGQGEVRIFMEYMAGGSLSSIVKTYGALPEPLIANFTKQITMA
LHYLHSHGVVHRDLKGANILSDGEGNIKLADFGASKHIQGLPLMSENSELCKSIRGSLYW
MAPEILKRESYGRKVDVWSLGCVIIEMATGKHPWDNIFTYEQLCQAVALQQKPEVPEHLS
NKCKDLISICLEYDKKKRANTGAVLKHPFLSSTS


>SteCoe_24084(CDS)
ATGGACTCTAATTGTATCAAAATCAAGATTAAAAAAGCTACAGCAACACCTCCAGATGTT
TCTTTAGACAACCTAAGTGATTCCGCACATAACATGACCCGAACAATAGGTCGAGATCTG
TTTTTTGCTTCTCTAAGCGAAAACCCTAGAAAATCCTTAGAACTAGAGCAAAAACACTTC
GATGTTCAAATGGAAAAAAAAATCGGCCAAGGGACATACGGGTCAGTTTACAGGGCAATC
CTAAAAGAAAACGGGGAATTCGTCGCAGTCAAAATCTTCAAAATTGAAATCTCCCGTGAC
AACTGGAGAGCGAAAGTTGAAGTCTTAGATAAAGAAATTTCGATTCTTAGAAGATTTGAA
AATTACAATATAGTAAAATACCTTGGAAGTGAAAAACTATTAAACAACAAAAATGGACAA
GGCGAAGTGCGTATTTTTATGGAATATATGGCTGGAGGTTCACTTAGTAGTATAGTGAAA
ACATATGGAGCTTTACCTGAGCCACTTATAGCAAATTTTACTAAACAAATTACTATGGCT
TTACATTATTTACATAGTCATGGAGTTGTTCATCGTGATTTAAAAGGGGCAAATATATTA
TCAGATGGTGAAGGGAATATAAAACTTGCTGATTTTGGGGCTAGTAAACATATACAAGGA
TTACCTTTGATGTCAGAAAATTCTGAGCTTTGTAAAAGTATTAGAGGGTCGTTGTATTGG
ATGGCTCCTGAGATTTTAAAACGTGAATCTTATGGAAGAAAAGTTGATGTTTGGTCTTTA
GGATGTGTGATTATTGAAATGGCCACTGGGAAACATCCTTGGGATAATATTTTTACTTAT
GAACAGTTGTGTCAGGCTGTAGCTTTACAACAGAAACCTGAGGTTCCAGAGCATTTGTCG
AATAAGTGCAAGGATTTGATTAGCATATGTCTGGAGTATGATAAGAAAAAAAGGGCTAAT
ACGGGAGCGGTACTTAAGCATCCTTTTCTATCTAGTACAAGCTAA