Identifiers and Description

Gene Model Identifier

SteCoe_24113

Standard Name

None

Aliases

None

Description

FKBP_C domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18830.0.g951.5628821893349888e-18FKBP-type peptidyl-prolyl cis-
trans isomerase

Tetrahymena ThermophilaTTHERM_002270404.248354255291589e-18Putative 12-kD FK506 binding p
rotein
Saccharomyces CerevisiaeYNL135C4.248354255291589e-18Peptidyl-prolyl cis-trans isom
erase (PPIase); binds to the d
rugs FK506 and rapamycin; also
binds to the nonhistone chrom
atin binding protein Hmo1p and
may regulate its assembly or
function; N-terminally propion
ylated in vivo
WormBaseWBGene000014274.248354255291589e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_24113(Protein)
MGVELQELKPGDGRSFPKKGQRVSVHYDGYLTNGQKFDSSRDRGQQFSFKLGAGEVIRGW
DEGVAQMSLGQKVRMTISPDFGYGARGAGGVIPPNATLLFDVELFSFK


>SteCoe_24113(CDS)
ATGGGTGTTGAACTACAAGAGCTTAAGCCAGGAGATGGGAGAAGCTTTCCAAAAAAAGGA
CAAAGAGTTTCTGTTCATTATGATGGGTACTTGACTAATGGGCAAAAATTCGACTCAAGC
AGAGATAGAGGTCAACAATTCTCATTTAAATTAGGAGCAGGAGAAGTTATTAGAGGTTGG
GATGAAGGTGTGGCTCAAATGTCACTAGGACAAAAAGTTAGAATGACAATATCACCAGAC
TTTGGCTATGGGGCTAGAGGAGCAGGAGGGGTTATTCCGCCAAATGCAACATTGCTTTTT
GATGTTGAACTTTTTAGCTTTAAATAG