Identifiers and Description

Gene Model Identifier

SteCoe_24164

Standard Name

None

Aliases

None

Description

Gp_dh_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (IEA) | GO:0016620

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18741.0.g631.4788975056432133e-74Glyceraldehyde 3-phosphate deh
ydrogenase, C-terminal domain

Tetrahymena ThermophilaTTHERM_005511601.1983630608508849e-70Glyceraldehyde-3-phosphate deh
ydrogenase; metabolic enzyme i
nvolved in glycoloysis
Saccharomyces CerevisiaeYJR009C2.4069765506104637e-69Glyceraldehyde-3-phosphate deh
ydrogenase (GAPDH), isozyme 2;
involved in glycolysis and gl
uconeogenesis; tetramer that c
atalyzes reaction of glycerald
ehyde-3-phosphate to 1,3 bis-p
hosphoglycerate; detected in c
ytoplasm and cell wall; protei
n abundance increases in respo
nse to DNA replication stress;
GAPDH-derived antimicrobial p
eptides are active against a w
ide variety of wine-related ye
asts and bateria; TDH2 has a p
aralog, TDH3, that arose from
the whole genome duplication
WormBaseWBGene000016832.6395702969591894e-66

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_24164(Protein)
MSVRVGINGFGRIGRLVLRAALANKQVSVQAVNDPFMDINYMAYLFKRDSVHGNYPGNVS
VQGSKIVVDGHEIQVLAEKDPTKLPWKSTGAEYVAECTGAFTNSEKLSMHLQAGASKVVL
SAPPKDDVPMFVMGVNHHKYTKDLKIVSNASCTTNCLAPLAKVVHENFGIVEGLMTTVHA
MTANQLTVDGPSKGGKDWRAGRAASGNIIPASTGAAKAVGKVIPELKGKITGMAFRVPTL
DVSVVDLTVKLAKPASYEEIVNAVKGAASGDMKGILGWTDEEVVSADFIHDSRSSIFDVK
AGIQLNPSFVKLVTWYDNEWGYSNRLIDLLVHISKQ


>SteCoe_24164(CDS)
ATGTCTGTACGTGTAGGGATAAACGGGTTTGGGAGAATAGGTCGCTTGGTCCTTAGAGCA
GCTTTAGCTAATAAACAAGTATCAGTCCAAGCAGTAAATGATCCTTTTATGGACATTAAC
TATATGGCTTACCTTTTCAAACGTGATTCAGTCCATGGAAATTACCCAGGAAATGTTTCA
GTTCAAGGTTCAAAAATTGTTGTAGATGGTCATGAAATCCAAGTCTTAGCTGAAAAAGAT
CCAACAAAACTCCCATGGAAATCAACTGGAGCTGAATATGTTGCTGAATGCACAGGGGCT
TTTACAAATTCAGAAAAATTATCAATGCATCTTCAAGCTGGGGCTTCAAAAGTTGTCCTT
TCAGCTCCACCAAAAGATGATGTTCCAATGTTTGTTATGGGTGTTAATCATCATAAGTAT
ACAAAAGATCTTAAAATTGTGTCAAATGCTTCTTGTACTACAAATTGTCTTGCCCCATTA
GCTAAAGTTGTTCATGAAAATTTTGGTATTGTTGAAGGATTAATGACAACTGTTCATGCT
ATGACGGCAAATCAATTAACTGTTGATGGTCCTTCTAAAGGAGGTAAAGATTGGAGGGCT
GGTCGTGCGGCCAGCGGAAATATTATACCTGCATCTACTGGTGCTGCTAAAGCTGTGGGT
AAAGTTATTCCTGAACTTAAAGGAAAAATTACTGGTATGGCATTTAGAGTACCAACTTTA
GATGTTTCGGTTGTTGATTTAACTGTGAAATTAGCTAAACCTGCAAGTTATGAAGAAATT
GTTAATGCGGTTAAAGGTGCGGCTAGTGGGGATATGAAAGGGATTCTTGGGTGGACTGAT
GAAGAAGTTGTTAGTGCTGATTTTATTCATGACTCAAGATCAAGCATTTTTGATGTGAAA
GCTGGAATTCAGTTAAACCCTTCGTTTGTCAAACTTGTCACTTGGTATGATAATGAATGG
GGATACTCGAATAGGCTTATTGATTTGCTTGTTCACATTTCTAAGCAATAA