Identifiers and Description

Gene Model Identifier

SteCoe_24182

Standard Name

None

Aliases

None

Description

Telomerase_RBD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig1013.1.g899.602680054508676e-24Telomerase ribonucleoprotein c
omplex - RNA binding domain

Tetrahymena ThermophilaTTHERM_001125601.1548224173015786e-17telomerase holoenzyme subunit
of 133 kDa (p133) containing t
he enzyme active site; essenti
al gene; knockdown induces tel
omere shortening

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_24182(Protein)
MEEYLALLNSIKPLGDYPVSSSFTDFLKSTVICLHNDYAFPCDFVVRVRHNHCSLVDATI
SMILSKKNSDNGLRLEEPVQTLGYSLYKVSGNMRKNPMVTLTLKXAFPCDFVVRVRHNHC
SLVDATISMILSKKNSDNGLRLEEPVQTLGYSLYKVSGNMRKNPMVTLTLKSPEWECLHK
YIGDDLTMHLIQGENLSIFMKNADSLIQVIGTNIAKFLKPKEPKNKNLLSLKKMKDFKSS
KKFQEDFKLKQDILSKLPPINKIKMLYNPLIRKKFKLSAKNPLNLPPIQAGPAIAKKILG
PRSKNKYLFTLSKFFGKFTYNYQRQNIGSHINKHCPMPKDFKKSFAQNLSADFSFEWLFS
NNCSLTSVGTFLITLVKKIVPLELLGSRHNMKSLQKGMISFLKLGVWEKISCAAICSRFR
MKDFKWIHESADTSRRLLVGKIVSYIFNDFVIPLLQVSFYVTEKQHDNTALFFYRKPVWA
IITYNVNQKLENSKFFSMLTIEEKKRWEDFTKFPPAKLRVQPKVKDFRPIMHFKSKVNVS
PNVRLSGNNLIAGLPQILRACLVDLDKHPKDRVLSSYQFQNISDKIMCLDYPSIIGKLTD
FQKAWQDKGRPELYFMCMDIAKAFDSVKIDSLIQMLENVEIPVISSYYKYIQLLPRFARK
AQGPLQGLFKMKYKKQAVDEGKFPFFNDMNFRPQSINILTSRTNFITSEKIKMVSRVLQG
NVIKFNRRYYKGQQGVPQGLPCSPLLSNLYYSKVEQSLLPSILKYQTKDLLLIIRLHDDY
LILSDCKDTVSSVFQEMESMANSHSFHFASHKISSNLPGNWVEKPDIEAWVGLDIDKNLQ
ISPHVSENAKKQISFDFIASSVNIIDLKNKLIKMTNLTINLLRFRASSQEEVLKKALSRL
MNLQSSRFLALLKIVRKVYRCKHSSNAISRIIVNVVKFSAKLVEIPDFVKISLKEFVVVF
KNTELHSVSQKLKGYLGKL


>SteCoe_24182(CDS)
ATGGAAGAGTATTTGGCTTTGCTGAATTCAATAAAACCACTTGGTGACTATCCTGTAAGC
TCAAGTTTTACTGATTTTTTAAAAAGTACAGTGATATGTTTGCATAATGATTATGCTTTT
CCTTGTGATTTTGTTGTTAGGGTTAGGCATAATCATTGTAGTTTGGTTGATGCAACAATT
TCTATGATTTTATCTAAGAAAAACTCGGATAATGGGTTGAGACTTGAGGAACCTGTGCAA
ACTTTGGGATACTCGTTGTATAAGGTTAGTGGAAATATGCGGAAAAACCCAATGGTTACA
CTTACTTTGAAANATGCTTTTCCTTGTGATTTTGTTGTTAGGGTTAGGCATAATCATTGT
AGTTTGGTTGATGCAACGATTTCTATGATTTTGTCTAAGAAAAACTCGGATAATGGGTTG
AGACTTGAGGAACCTGTGCAGACTTTGGGATACTCGTTGTATAAGGTTAGTGGAAATATG
CGGAAAAATCCAATGGTTACACTTACTTTGAAAAGTCCTGAGTGGGAATGTTTGCATAAG
TATATTGGCGATGATCTTACTATGCATCTTATCCAAGGCGAAAATCTTAGTATTTTCATG
AAAAATGCAGACTCCTTAATCCAAGTCATCGGGACAAACATCGCGAAATTCCTCAAACCC
AAAGAACCCAAAAACAAAAACCTCCTTAGTCTAAAAAAAATGAAGGACTTCAAATCTAGT
AAAAAATTCCAAGAAGACTTTAAACTTAAACAAGATATCTTAAGCAAACTCCCCCCAATC
AATAAAATCAAAATGCTCTACAACCCCCTTATTAGGAAAAAATTCAAACTTTCAGCTAAA
AACCCTCTAAACCTCCCCCCCATTCAGGCGGGACCAGCAATAGCTAAAAAAATCCTAGGC
CCGCGCAGTAAAAATAAATACCTTTTTACCTTATCTAAATTTTTCGGTAAATTTACTTAT
AATTACCAAAGGCAAAATATAGGTTCACATATAAACAAACATTGTCCAATGCCAAAAGAT
TTCAAAAAATCATTTGCTCAGAATCTTTCAGCTGATTTTTCTTTTGAATGGCTTTTTTCT
AACAACTGTTCCTTAACTTCTGTTGGGACTTTCCTTATAACTCTAGTTAAAAAAATTGTC
CCTTTAGAGTTACTTGGTAGTCGACATAATATGAAATCTTTACAAAAAGGGATGATTTCA
TTTCTTAAATTGGGTGTTTGGGAAAAAATATCTTGTGCGGCGATTTGTAGTAGGTTTAGA
ATGAAAGATTTTAAATGGATTCATGAATCTGCTGATACTTCTCGAAGACTTTTGGTTGGT
AAAATTGTTTCATATATTTTTAATGACTTTGTTATACCTTTATTACAAGTATCTTTTTAT
GTAACTGAGAAACAACATGATAATACAGCGCTTTTTTTTTATAGGAAACCAGTATGGGCG
ATTATTACTTATAATGTGAATCAGAAATTGGAAAACTCGAAGTTTTTTAGTATGCTGACG
ATTGAAGAAAAAAAAAGATGGGAAGATTTTACGAAGTTTCCCCCAGCAAAACTTAGGGTG
CAACCTAAAGTTAAGGATTTTAGGCCGATTATGCATTTTAAGTCTAAAGTTAATGTCTCG
CCTAATGTCCGTTTGTCAGGGAATAATCTTATTGCTGGTCTGCCACAGATATTAAGGGCA
TGTTTGGTGGATTTAGATAAACATCCTAAGGATCGAGTTTTGTCTTCATATCAATTCCAA
AATATTTCTGATAAAATCATGTGCCTGGACTATCCTTCAATTATTGGAAAACTCACTGAT
TTCCAAAAAGCTTGGCAAGATAAAGGTCGCCCTGAACTATATTTCATGTGTATGGACATC
GCAAAAGCTTTTGACTCAGTGAAAATCGACAGTTTAATCCAAATGCTTGAAAACGTCGAA
ATACCAGTTATATCATCTTATTATAAATACATTCAACTTCTTCCACGCTTTGCTCGCAAA
GCGCAAGGTCCATTACAAGGTCTTTTTAAAATGAAATATAAAAAACAAGCTGTCGATGAA
GGCAAATTCCCATTTTTTAACGATATGAATTTCCGCCCACAATCAATAAACATCTTAACT
TCAAGGACAAATTTTATCACATCAGAAAAAATCAAAATGGTTAGTAGGGTATTACAAGGT
AATGTTATAAAATTTAATAGAAGATATTATAAAGGTCAACAAGGTGTACCTCAAGGATTA
CCATGTTCACCTTTATTATCAAATTTATATTATTCAAAGGTTGAACAGAGTCTTTTGCCT
AGTATTTTGAAATATCAAACTAAAGATTTACTACTTATTATTAGACTGCATGATGATTAT
TTAATACTTAGTGATTGTAAAGATACTGTTAGTAGTGTGTTTCAGGAGATGGAGAGTATG
GCGAATAGTCATAGTTTTCACTTTGCTAGCCATAAAATATCTAGTAATCTACCTGGGAAC
TGGGTAGAAAAACCTGATATCGAAGCTTGGGTTGGACTAGACATTGACAAAAACCTACAA
ATCAGCCCTCACGTGAGCGAAAACGCTAAAAAGCAAATCTCCTTTGACTTCATAGCAAGT
TCCGTAAATATCATCGACCTTAAAAACAAACTCATAAAAATGACAAACCTAACAATAAAT
CTTCTCCGTTTTAGAGCTTCATCCCAAGAAGAAGTTTTAAAAAAAGCATTAAGTCGACTA
ATGAACCTTCAATCAAGTAGATTTTTAGCATTACTCAAAATAGTCCGTAAAGTATATAGG
TGTAAGCATTCCTCAAATGCAATTAGTAGAATTATAGTCAACGTTGTGAAGTTCTCAGCA
AAGCTTGTAGAAATCCCTGATTTTGTGAAAATCTCATTAAAAGAGTTTGTTGTTGTGTTT
AAAAACACAGAATTACATTCTGTGAGCCAAAAACTTAAAGGATATTTAGGGAAATTATAA