Identifiers and Description

Gene Model Identifier

SteCoe_24344

Standard Name

None

Aliases

None

Description

eIF-6 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007325901.2806276389220833e-57translation initiation factor
eIF-6, putative family protein
Saccharomyces CerevisiaeYPR016C1.9006199352650016e-55Constituent of 66S pre-ribosom
al particles; has similarity t
o human translation initiation
factor 6 (eIF6); may be invol
ved in the biogenesis and or s
tability of 60S ribosomal subu
nits
Oxytricha TrifallaxContig6289.0.g51.9006199352650016e-55eIF-6 family

WormBaseWBGene000012343.720075976020836e-44

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_24344(Protein)
MATRTMFENSNEVGVFSKLTNKYCMVAVGGNENFYSVFESELAGHIPVIHTSIAGTRIVG
RVTSGNSNGLLVPSITTDNELQLLRNSLPDSIKIERVEERLSALGNCIACNDYVALIHPD
LDKETEDIIADTLKVEVFRTMVAGNVLVGSYCSLSNQGGLVHPMVSIEELDELSSLLQIP
LCAGTVNRGSDVIAAGLVVNDWSAFCGADTTSTEISVIENIFRLNEVKQGGGQAGVRTGL
VDNL


>SteCoe_24344(CDS)
ATGGCCACCAGGACTATGTTTGAGAACTCGAATGAAGTGGGTGTTTTTTCCAAACTGACC
AACAAATACTGTATGGTTGCAGTTGGAGGAAACGAAAACTTCTACAGCGTTTTCGAAAGT
GAGCTTGCAGGCCACATCCCAGTGATCCACACATCAATAGCAGGTACTAGAATTGTTGGT
AGGGTCACATCAGGAAACTCAAATGGCCTTCTAGTCCCAAGTATAACAACAGACAATGAA
TTACAGCTTCTTCGTAACTCGCTTCCAGACTCAATCAAAATCGAAAGAGTAGAAGAAAGA
CTTTCAGCCTTAGGTAATTGTATAGCATGCAATGATTATGTTGCATTAATTCACCCTGAC
TTAGATAAAGAAACTGAAGATATTATTGCAGATACACTAAAAGTTGAGGTTTTCAGAACG
ATGGTCGCTGGGAATGTCCTTGTTGGCAGCTACTGTTCTCTTTCTAATCAAGGAGGTCTT
GTACATCCGATGGTTTCTATTGAAGAATTAGATGAATTAAGCTCACTTTTACAAATCCCT
TTGTGTGCTGGGACTGTTAATCGTGGAAGCGATGTTATTGCTGCTGGTCTAGTCGTCAAT
GATTGGAGCGCTTTCTGTGGTGCAGACACGACTTCAACAGAAATCTCGGTTATTGAAAAT
ATCTTCAGGCTTAATGAAGTCAAACAAGGGGGAGGACAAGCTGGAGTCCGTACTGGGCTC
GTAGATAATTTGTAG