Identifiers and Description

Gene Model Identifier

SteCoe_24478

Standard Name

None

Aliases

None

Description

Cation_ATPase_N domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig21999.0.g1280E1-E2 ATPase

WormBaseWBGene000011370
Saccharomyces CerevisiaeYGL167C1.8521167695179754e-45High affinity Ca2+/Mn2+ P-type
ATPase; required for Ca2+ and
Mn2+ transport into Golgi; in
volved in Ca2+ dependent prote
in sorting and processing; D53
A mutant (Mn2+ transporting) i
s rapamycin sensitive, Q783A m
utant (Ca2+ transporting) is r
apamycin resistant; Mn2+ trans
port into Golgi lumen appears
to be required for rapamycin s
ensitivity; mutations in human
homolog ATP2C1 cause acanthol
ytic skin condition Hailey-Hai
ley disease

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_24478(Protein)
MAIRRTTSSFIIGFEELKQKIELADNAEAAKKEIGRGVDKAADKKGKKGKDKEKSMDAVK
DTESFRNMNEHFIPLEDLCAKLETDIHKGLTEEAADAKIKILGPNKLSEKKPTPWYCVFL
KTLLGFFSLLLWAGSFLCLIAYGLDQTDPSNLYLGIVLAIVVIITACFSFYQESKSAAIM
AGFKNMIPPVTTIVRAGRQMEVESSVLVPGDLVHLKAGARIPADLRIIEANNNLKVDNSS
LTGESEPLTRSVECTNQKAPLETKNLAFFGTTCAEGTGKGIVVNTGDRTVIGAIAKLTNV
TEAEETTLGKEIARFIKMISIVAVSFGVVFFVIGAGYGYNMVVNMVNAIGIIVANVPEGL
LATVTVSLSITAKKMAEKHVLVKNLESVETLGSTTCICSDKTGTLTENKMTIVALWYDLV
GREVINYERREDVESLGYSIKDQSFKYMQYCATLNNKTQWNFEPDKNKLQDEQGNQLPEE
ELIRVREEYKKEIQSKSIKTWPIMGGDASETAMIKFFHPITDIDKIREQYPILKRQGIKG
EIPFNSANKYALTLHEPVDFAPPEHQQDCVMFMKGAPEQIWARCDYILIEGHPQKISSEH
KESFAKANRHYGGQGRRVLGFAMYWLPSDIYDSEYVFDPTLKDGPNFPLSGLTFIGLGAL
EDPPKLRVKEAVESCNHAGIKVVMVTGDQPLTAAAIARQVSIITQTKTVNEIAEEKGVDF
FTIMDESDAIVVHGESLSKFVEEDKDLPFEEQRLTIFLKKKEVVFARTSPAQKYMIVDCA
QKLKHIVAVTGDGVNDSPAIKKADIGIAMAIVGSDVAKDAADMLLMDDNFASIVDGVEEG
RKIFDNLKKSIAYTLASNIPELAPFLSLVIFQIPLPLSTVLILCIDLGTDMVPAVSLAYE
YPELDIMFRKPRNSHEDHLVSGKLLISAYMIIGMIQCIAGYLAYFIVLYDYGMPPWNLLF
LALSKDGTEPNVNDIYNPDHKYKGNTHVGNSAYDGAQVDYISQNHAKYDLRIWYWKIEHW
SECRFPGDNSPVRNATVCYSTEAVKYAQYAYFIAIVVVQWSNLIIVKTKKISIIEHGFRN
RVSWWGLLSESIITVMIGFIPGLNVSLGGRPLHFLHWYFPAMPVFMLIILYDEIRKLIMR
KTSERHKRNGIDKVGWVEENTLY


>SteCoe_24478(CDS)
ATGGCGATCAGAAGGACAACAAGTTCTTTTATCATTGGCTTTGAAGAGCTCAAGCAAAAA
ATCGAATTAGCCGATAACGCTGAAGCTGCTAAAAAAGAAATCGGTCGAGGAGTTGATAAA
GCTGCTGATAAAAAAGGCAAAAAGGGGAAAGATAAAGAAAAGTCCATGGATGCTGTAAAA
GACACAGAATCTTTTAGGAATATGAATGAGCATTTTATCCCTTTAGAAGACCTTTGCGCT
AAATTAGAAACAGATATTCATAAAGGACTTACTGAAGAGGCAGCTGATGCTAAAATTAAA
ATTCTTGGACCAAATAAGTTATCAGAAAAAAAACCAACTCCATGGTATTGCGTTTTCCTA
AAAACACTTTTAGGTTTTTTTTCATTACTTCTATGGGCAGGGTCATTTTTATGTTTGATT
GCTTATGGTCTAGATCAAACTGATCCATCGAATTTGTATTTAGGTATCGTTTTAGCTATA
GTCGTTATTATAACGGCATGTTTTAGTTTCTACCAAGAATCTAAATCTGCTGCAATTATG
GCTGGGTTTAAAAATATGATACCTCCAGTTACTACTATAGTTAGAGCAGGACGTCAAATG
GAAGTTGAAAGTTCTGTATTAGTCCCTGGAGACCTTGTTCATTTAAAAGCTGGTGCAAGA
ATTCCTGCTGACCTTAGGATTATTGAAGCTAACAACAATTTAAAAGTTGACAATTCGTCT
TTGACTGGAGAATCTGAACCACTTACAAGAAGTGTTGAATGTACTAATCAAAAAGCTCCT
TTAGAGACTAAAAATTTAGCTTTTTTTGGAACTACATGTGCTGAAGGAACAGGTAAAGGA
ATTGTGGTTAATACAGGGGATAGAACTGTTATTGGAGCTATAGCAAAACTTACTAATGTG
ACTGAGGCTGAAGAGACAACATTAGGTAAAGAAATTGCTAGGTTTATAAAAATGATCAGT
ATTGTTGCTGTATCTTTTGGTGTTGTGTTTTTTGTTATTGGGGCTGGATATGGATATAAT
ATGGTTGTTAATATGGTTAATGCTATTGGGATTATTGTCGCTAATGTACCTGAAGGACTT
TTAGCTACTGTGACTGTAAGTTTGAGTATTACAGCAAAAAAAATGGCAGAAAAACATGTG
CTGGTGAAAAACTTGGAGTCTGTTGAAACTTTAGGATCAACAACTTGTATATGTTCAGAT
AAAACTGGGACTTTAACTGAAAATAAAATGACTATTGTAGCTTTGTGGTATGACCTTGTT
GGAAGAGAAGTTATTAATTATGAAAGAAGAGAAGATGTTGAAAGTTTAGGGTATAGTATA
AAAGATCAGTCGTTTAAATATATGCAATATTGTGCAACTTTAAATAATAAAACTCAATGG
AATTTCGAACCTGATAAAAATAAACTACAAGATGAACAGGGAAACCAGTTACCAGAAGAA
GAGCTTATAAGGGTGAGAGAAGAGTATAAAAAAGAAATTCAGTCAAAGTCGATTAAAACA
TGGCCGATTATGGGTGGTGATGCTAGTGAAACTGCTATGATCAAATTTTTCCACCCTATT
ACCGATATTGATAAAATCCGAGAACAATACCCTATACTTAAAAGACAAGGGATAAAAGGT
GAAATCCCATTTAACTCTGCAAATAAATATGCTTTAACTTTACATGAACCAGTTGATTTC
GCCCCACCTGAGCATCAACAAGACTGTGTTATGTTTATGAAAGGAGCTCCAGAACAAATC
TGGGCTCGTTGTGATTATATTCTTATTGAAGGTCATCCTCAAAAAATATCTTCAGAACAT
AAAGAATCCTTTGCTAAAGCTAACAGACATTATGGAGGCCAAGGACGTCGTGTTTTAGGT
TTTGCAATGTATTGGTTACCATCTGATATCTATGATTCTGAATATGTTTTTGATCCAACT
CTTAAAGATGGGCCTAATTTCCCTCTTAGTGGTCTAACATTTATTGGCCTTGGTGCACTT
GAAGATCCTCCTAAACTAAGAGTTAAAGAAGCTGTTGAATCTTGTAATCATGCTGGAATC
AAAGTTGTCATGGTTACAGGAGATCAACCACTTACTGCTGCTGCTATTGCAAGACAAGTT
TCTATTATAACCCAAACTAAAACTGTTAATGAAATCGCTGAAGAAAAAGGTGTGGACTTT
TTTACAATCATGGATGAAAGTGATGCTATTGTTGTACATGGAGAGTCATTATCAAAATTT
GTAGAAGAAGATAAGGATTTACCATTTGAAGAACAAAGATTGACTATATTTTTAAAGAAA
AAAGAAGTTGTTTTTGCTAGAACATCACCCGCTCAAAAGTATATGATTGTAGACTGTGCA
CAAAAACTTAAACATATTGTTGCTGTTACAGGAGATGGGGTTAATGATAGTCCAGCTATT
AAAAAAGCAGATATTGGTATTGCTATGGCTATTGTAGGTAGTGATGTTGCTAAAGATGCT
GCAGATATGCTATTGATGGATGATAATTTTGCTTCAATTGTTGATGGAGTTGAAGAAGGG
AGGAAAATTTTTGATAATCTGAAAAAGTCAATTGCTTATACTTTAGCTTCGAATATCCCA
GAATTAGCACCTTTTTTATCGTTGGTAATTTTCCAGATTCCTTTACCTTTATCAACAGTA
TTAATTTTATGTATTGACTTAGGAACAGATATGGTTCCTGCAGTATCTTTAGCTTATGAG
TATCCTGAATTAGACATTATGTTCCGTAAACCTAGAAATTCTCATGAAGACCATTTGGTT
TCAGGAAAACTTCTTATAAGTGCTTATATGATAATAGGGATGATTCAATGTATTGCTGGA
TATTTAGCTTATTTTATTGTATTATATGATTACGGTATGCCTCCATGGAATCTTCTTTTC
TTAGCTTTAAGTAAAGATGGGACCGAGCCGAATGTCAATGATATTTACAACCCTGACCAT
AAATACAAAGGAAATACTCATGTAGGGAATTCTGCTTATGATGGTGCTCAAGTTGATTAT
ATAAGCCAAAATCATGCAAAATATGATCTTCGTATATGGTATTGGAAAATTGAACATTGG
AGTGAATGTAGATTCCCTGGTGATAATTCTCCAGTTAGAAATGCAACAGTTTGTTATAGT
ACTGAAGCTGTAAAATATGCTCAATACGCTTATTTTATAGCAATTGTTGTGGTTCAATGG
TCTAATTTGATTATTGTTAAGACTAAAAAAATTTCTATTATTGAACATGGGTTTAGAAAT
CGAGTATCATGGTGGGGTTTGCTTTCAGAGTCAATTATTACGGTTATGATTGGGTTTATT
CCAGGATTAAATGTTTCACTTGGAGGACGGCCTTTACACTTTTTGCATTGGTATTTCCCG
GCAATGCCTGTTTTTATGCTGATTATTTTGTATGATGAGATAAGGAAACTTATTATGAGG
AAAACTTCTGAGAGACATAAACGTAATGGAATTGACAAGGTTGGATGGGTTGAAGAAAAT
ACTCTTTATTAG