Identifiers and Description

Gene Model Identifier

SteCoe_24647

Standard Name

None

Aliases

None

Description

KH_6 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig20442.0.g900.00000000000009357622968840175Tht1-like nuclear fusion prote
in

Tetrahymena ThermophilaTTHERM_010505900.0000000000006914400106940203component of the exosome exonu
clease complex
WormBaseWBGene000103250.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_24647(Protein)
MVEKFYERKCPVKYCSEIGDLVIGRILDRQGEHYRVDIGDRFEALLQFYDFEGATKRNRP
NLDHGDLVYVRVLRTSQNTGAMLTGKSLNNKKTWSSGEAEFGPLTGGYPLTCPISLIQHL
MNPKGCENLESLGQCFKFDLVLGYNGKIWLSTLDPIKTIIIANALQKVTLPVSEFSTLLN
KIKSFC


>SteCoe_24647(CDS)
ATGGTTGAGAAGTTCTATGAACGAAAATGCCCTGTCAAGTACTGTTCTGAAATTGGAGAT
CTTGTTATTGGGAGGATTCTTGATAGACAAGGGGAGCATTATAGGGTTGATATTGGCGAT
CGTTTCGAAGCACTTCTTCAATTCTATGACTTTGAAGGTGCTACGAAGAGGAACAGACCT
AATTTGGATCATGGAGATCTTGTGTATGTGAGAGTTCTTAGAACTAGCCAGAACACTGGC
GCTATGCTCACTGGCAAGTCTCTAAACAACAAAAAAACCTGGAGTTCAGGTGAAGCTGAA
TTCGGTCCTCTCACAGGAGGTTATCCTCTAACCTGCCCTATCTCTCTAATCCAACATCTA
ATGAACCCAAAAGGTTGTGAAAATCTTGAATCCCTAGGCCAGTGTTTTAAATTTGATTTA
GTCCTAGGTTACAATGGCAAAATTTGGCTGAGTACTTTAGACCCTATAAAAACTATTATA
ATCGCTAATGCTTTACAAAAAGTGACCCTCCCAGTTAGTGAATTCAGCACCCTTTTAAAC
AAAATCAAAAGTTTCTGTTAA