Identifiers and Description

Gene Model Identifier

SteCoe_24798

Standard Name

None

Aliases

None

Description

Cpn10 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007706900.0000000001026187963170189chaperonin, 10 kDa family prot
ein
Saccharomyces CerevisiaeYOR020C0.00000001522997974471263Mitochondrial matrix co-chaper
onin; inhibits the ATPase acti
vity of Hsp60p, a mitochondria
l chaperonin; involved in prot
ein folding and sorting in the
mitochondria; 10 kD heat shoc
k protein with similarity to E
. coli groES

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_24798(Protein)
MFSQFRKFTPLLNRVVIKRLDAPKKSAGGILLPESAEKDLQVGEVVSAGPGTYDDYGNFQ
ATGVKEGQKVLLPAYGGQVFDFQDQKFTIYKDSEILAVLE


>SteCoe_24798(CDS)
ATGTTTAGTCAGTTTAGGAAATTCACTCCTTTGCTAAACCGAGTTGTAATAAAGCGCCTT
GATGCTCCAAAAAAATCAGCAGGGGGTATTTTATTACCAGAATCAGCAGAAAAAGACCTA
CAAGTTGGAGAAGTTGTCTCAGCAGGGCCAGGGACCTATGACGACTATGGGAATTTTCAA
GCAACTGGGGTAAAAGAAGGCCAAAAGGTACTTCTTCCAGCTTATGGTGGGCAAGTTTTT
GATTTCCAAGACCAAAAGTTTACAATATACAAAGACTCAGAAATTTTAGCAGTTCTAGAA
TAA