Identifiers and Description

Gene Model Identifier

SteCoe_25044

Standard Name

None

Aliases

None

Description

Aldo_ket_red domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig7168.0.g725.166420632837861e-55Aldo/keto reductase family

Tetrahymena ThermophilaTTHERM_003006201.6889118802245324e-48oxidoreductase, aldo/keto redu
ctase family protein
Saccharomyces CerevisiaeYPL088W0.00000000000009357622968840175Putative aryl alcohol dehydrog
enase; transcription is activa
ted by paralogous transcriptio
n factors Yrm1p and Yrr1p alon
g with genes involved in multi
drug resistance
WormBaseWBGene000031760.000045399929762484854

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_25044(Protein)
MVEKDTMIYRNLGNSGLKVSALSIGNWLTGHSLDFEETQFQVFSRFVNAGVNFLDTAEIY
GAGNAETILGNIIKRGDWDRDKLVVSTKFLRCGGSVGLSRKRLIQSMKKSLSRLQLDYVD
IMFLHRYDHEVPLEETIRAVNHLIEKGKASYWGTSEFTAQQLMECYKVCDKLGYEYPIAE
QCQYSMLIRENVEVTLPHLFDNYGLGTTVWSPISGGLLSGKYNDGTIPEGSRLADPSLAP
MVRERYMSYFAEANREKTLNMFKGLKDIANELGASQAQLALAWCIKNEDVSTALCGASRV
EQVDDNLGSLELLNKLDDGMLRRIEDVLGNRPTPPMDYRKWAPRPPRR


>SteCoe_25044(CDS)
ATGGTTGAGAAAGACACTATGATATACAGGAATCTAGGGAATTCCGGTCTTAAAGTCTCT
GCCCTATCAATAGGAAACTGGCTGACTGGACATTCCTTAGACTTTGAGGAAACTCAATTT
CAAGTCTTTTCTCGCTTCGTTAATGCTGGAGTAAATTTCCTTGACACAGCAGAAATTTAT
GGTGCTGGAAATGCCGAAACAATCCTAGGTAATATCATTAAACGTGGTGATTGGGATAGA
GACAAACTTGTAGTCTCAACAAAATTCTTAAGATGTGGAGGTTCAGTCGGTCTTAGTCGT
AAAAGGCTTATCCAGTCAATGAAAAAATCCCTCTCACGTCTTCAGCTTGACTATGTAGAC
ATTATGTTTCTACACAGATACGATCATGAAGTCCCATTAGAAGAGACAATTAGAGCAGTA
AACCATCTTATAGAAAAAGGTAAAGCAAGTTACTGGGGAACATCAGAATTTACAGCTCAA
CAACTTATGGAATGTTATAAAGTCTGTGATAAATTAGGTTATGAATACCCAATAGCTGAA
CAATGCCAATATTCTATGCTTATAAGAGAAAATGTTGAAGTCACATTACCTCATCTTTTT
GATAATTATGGTCTTGGTACAACAGTCTGGAGTCCAATATCTGGTGGATTACTTTCTGGT
AAATATAATGATGGGACTATTCCTGAAGGCTCAAGATTAGCTGATCCAAGTTTAGCCCCT
ATGGTAAGAGAAAGGTATATGTCTTATTTTGCTGAAGCTAATAGAGAGAAAACTTTGAAT
ATGTTTAAAGGACTTAAAGATATTGCTAATGAATTAGGGGCTAGTCAAGCACAATTAGCT
TTAGCTTGGTGTATTAAGAATGAAGATGTTAGTACTGCTCTTTGTGGAGCTTCAAGAGTT
GAACAAGTTGATGACAATTTAGGGTCACTTGAGTTGTTGAATAAATTAGATGATGGAATG
CTGAGAAGAATTGAAGATGTCCTTGGAAATAGACCTACACCACCTATGGACTATAGAAAA
TGGGCACCAAGACCACCAAGAAGATAG