Identifiers and Description

Gene Model Identifier

SteCoe_25123

Standard Name

None

Aliases

None

Description

JAB domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000044675.814040485895939e-62
Tetrahymena ThermophilaTTHERM_004768102.3455513385429143e-59Mov34/MPN/PAD-1 family protein
Oxytricha TrifallaxContig19310.0.g1091.733141042341547e-58JAB1/Mov34/MPN/PAD-1 ubiquitin
protease

Saccharomyces CerevisiaeYFR004W3.4811068399043105e-57Metalloprotease subunit of 19S
regulatory particle; part of
26S proteasome lid; couples th
e deubiquitination and degrada
tion of proteasome substrates;
involved, independent of cata
lytic activity, in fission of
mitochondria and peroxisomes;
protein abundance increases in
response to DNA replication s
tress

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_25123(Protein)
MLSSQLGRQSGAGDIQLVDTSEQIYISSLALLKMLKHGRAGVPLEVMGLLLGELVDDYTV
RVVDVFAMPQSGTGVSVESIDEAFQINMTEMLKLTGRGEMVVGWYHSHPGFGCWLSGVDM
NTQQSFEQQLSRAVAVVIDPIQSVRGKVVIDAFRLINPQVLMRGMEPRQTTSNIGHLNKP
SITALLHGLNRHYYSLAINYRKNELEQSMLLNLQKKKWVQGLKVEDFKKREEENLKTVEE
MLSLAENYNKWIQDEMKKTKQEMVVSTVGKLDPKKRLEQDVDSVMTQNILHSLGSMIDTV
IF


>SteCoe_25123(CDS)
ATGCTATCAAGCCAATTAGGCCGGCAATCAGGTGCTGGTGATATTCAACTTGTAGACACA
AGTGAACAGATCTACATTTCCTCTTTAGCACTTCTAAAAATGCTCAAACATGGTCGTGCA
GGTGTTCCTCTTGAAGTTATGGGTCTTCTCTTAGGTGAATTAGTCGATGACTATACCGTA
CGTGTTGTCGATGTTTTTGCTATGCCTCAATCAGGTACTGGAGTAAGTGTTGAATCAATA
GATGAAGCATTTCAAATCAACATGACAGAAATGCTTAAACTTACCGGTAGAGGTGAAATG
GTTGTAGGATGGTATCATTCACATCCTGGTTTTGGTTGTTGGCTTAGTGGTGTAGATATG
AACACTCAACAAAGTTTTGAACAACAATTATCAAGAGCTGTTGCTGTAGTCATTGATCCT
ATTCAAAGTGTTAGAGGTAAAGTTGTCATTGATGCTTTTAGACTTATTAATCCACAAGTA
CTTATGAGAGGAATGGAACCTAGACAAACTACATCAAATATTGGGCATTTGAATAAACCA
TCTATAACAGCTTTATTACATGGGCTTAATAGACATTATTATTCTTTGGCTATAAATTAT
AGGAAGAATGAACTTGAACAATCAATGTTGTTGAATTTACAGAAAAAAAAATGGGTGCAA
GGGTTGAAAGTTGAAGATTTTAAGAAGAGGGAGGAGGAGAATTTGAAAACTGTTGAGGAA
ATGCTCAGCTTAGCGGAGAATTATAATAAGTGGATACAGGATGAGATGAAAAAAACTAAG
CAGGAGATGGTTGTGAGTACAGTAGGGAAACTGGATCCGAAGAAAAGGTTAGAACAGGAT
GTTGATAGTGTTATGACGCAGAATATACTTCATTCGCTTGGTTCTATGATAGATACAGTT
ATTTTTTAG