Identifiers and Description

Gene Model Identifier

SteCoe_25145

Standard Name

None

Aliases

None

Description

RrnaAD domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig22762.0.g473.817497188671175e-54Ribosomal RNA adenine dimethyl
ase

Tetrahymena ThermophilaTTHERM_007261207.667648073722e-53dimethyladenosine transferase
family protein
Saccharomyces CerevisiaeYPL266W1.5400882849875202e-51Essential 18S rRNA dimethylase
(dimethyladenosine transferas
e); responsible for conserved
m6(2)Am6(2)A dimethylation in
3'-terminal loop of 18S rRNA,
part of 90S and 40S pre-partic
les in nucleolus, involved in
pre-ribosomal RNA processing
WormBaseWBGene000084554.590938473882946e-48

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_25145(Protein)
MEGPSFHTFEFDKTKGQHILKNPMIVKAIIDKSAIRSTDIVLEIGPGTGNLTMSLLEKAK
KVIAIELDPRMVAEITKRVRASPYNKNFEVICGDVLHTELPFFDICVSNVPYQISSPLVF
KLLTHRPLFRCAVLMFQREFAMRLVARPGSELYCRLSCNTQLLARVDHLLKVSKNNFRPP
PKVESSVVRIEPRNPVPEMNFTEWDGFVRICFMRKNKTLGAIFKQKSVIEMLEKNYVLLR
EANGEGPDMEEFKVKLGRIIQDFALNELRGNKMDLDDILNAIAVFNRHGIHFA


>SteCoe_25145(CDS)
ATGGAAGGCCCTTCATTTCACACCTTCGAATTCGACAAAACCAAAGGACAGCACATCCTC
AAAAACCCAATGATAGTAAAAGCCATCATAGACAAATCAGCAATAAGATCAACTGATATT
GTCCTTGAAATCGGCCCAGGCACAGGAAACTTAACAATGTCTCTTCTAGAAAAAGCTAAA
AAAGTTATAGCAATTGAACTTGATCCTCGTATGGTTGCCGAAATAACTAAAAGAGTTAGA
GCTAGTCCTTATAATAAAAACTTTGAAGTTATTTGTGGGGATGTTTTACATACAGAACTT
CCATTCTTTGATATCTGTGTCTCAAATGTTCCATATCAAATCTCTTCACCTTTAGTATTT
AAGCTTTTAACTCATCGTCCTTTATTTCGATGTGCAGTGCTTATGTTTCAAAGAGAATTT
GCTATGAGACTTGTTGCTAGACCAGGTAGTGAATTGTATTGCCGACTTTCTTGTAATACA
CAACTTTTAGCTAGAGTTGATCATTTGCTTAAAGTTAGTAAAAATAATTTTAGGCCACCA
CCAAAAGTTGAAAGTTCAGTTGTAAGAATTGAGCCTAGAAATCCTGTTCCTGAAATGAAC
TTCACTGAATGGGATGGGTTTGTGAGGATTTGTTTTATGAGGAAAAATAAGACTTTAGGG
GCTATTTTTAAACAGAAAAGTGTTATTGAAATGCTGGAAAAAAACTATGTGTTGCTAAGA
GAAGCCAATGGGGAAGGACCTGATATGGAGGAGTTTAAAGTGAAGCTTGGGAGGATTATA
CAAGATTTTGCGTTGAATGAGTTAAGAGGGAATAAAATGGATCTTGACGATATTTTGAAT
GCGATTGCTGTGTTTAATCGGCATGGAATACATTTCGCTTAG