Identifiers and Description

Gene Model Identifier

SteCoe_25160

Standard Name

None

Aliases

None

Description

Ras domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig7494.0.g641.5007857627073948e-41Ras family

WormBaseWBGene000042663.3057006267607343e-37
Tetrahymena ThermophilaTTHERM_001269507.281290178321643e-33Rab VIII family protein; small
monomeric GTPase that regulat
es membrane fusion and fission
events
Saccharomyces CerevisiaeYFL005W1.462486227251231e-31Rab family GTPase; essential f
or vesicle-mediated exocytic s
ecretion and autophagy; associ
ates with the exocyst componen
t Sec15p and may regulate pola
rized delivery of transport ve
sicles to the exocyst at the p
lasma membrane

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_25160(Protein)
MAKTAGQYDYLIKLLIIGDSGVGKTCFLLRFSDDNFTASHLTTIGIDFKLKTMEIDGKTI
KLQIWDTAGQERFRTITQTYYKGAMGIILAYDCTDENSFNNIRNWVQQIKMHASDNVSKV
LIGNKCDRPDKKITTEQGESLAQELGIKFFETSAKTNINVNETFKFIAKEIKDRRMVEAI
GTGGNIRVTGNKPEKKQGGCCGK


>SteCoe_25160(CDS)
ATGGCAAAAACTGCTGGCCAATACGACTACCTAATCAAGCTTTTAATCATAGGAGATTCA
GGTGTAGGCAAAACTTGTTTTCTACTAAGATTTTCCGATGACAATTTCACAGCTTCCCAC
TTAACAACAATAGGTATTGATTTCAAACTAAAAACCATGGAAATAGATGGGAAGACTATC
AAGCTTCAAATATGGGATACAGCAGGCCAAGAACGTTTCAGAACTATTACCCAAACTTAT
TATAAAGGAGCTATGGGGATTATTCTTGCTTATGATTGTACAGATGAAAATTCATTTAAC
AATATTAGAAATTGGGTCCAACAGATAAAAATGCATGCTAGTGATAATGTTTCAAAAGTA
CTTATTGGGAATAAATGTGATAGACCTGATAAGAAAATCACTACTGAACAAGGAGAATCT
TTAGCTCAAGAGCTTGGGATAAAGTTTTTTGAGACTAGTGCTAAAACGAATATCAATGTT
AATGAAACTTTTAAGTTTATAGCAAAAGAGATTAAAGATAGGAGGATGGTTGAAGCTATT
GGCACTGGAGGGAATATTAGAGTTACGGGGAATAAACCTGAGAAAAAACAAGGTGGGTGT
TGTGGTAAGTAG