Identifiers and Description

Gene Model Identifier

SteCoe_25228

Standard Name

None

Aliases

None

Description

Hist_deacetyl domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_003957106.813556821545298e-46Histone deacetylase family pro
tein
Oxytricha TrifallaxContig549.1.g141.8521167695179754e-45Histone deacetylase domain

WormBaseWBGene000079539.854154686111257e-34
Saccharomyces CerevisiaeYGL194C0.00000001522997974471263Histone deacetylase and subuni
t of Set3 and Rpd3L complexes;
required for gene activation
via specific deacetylation of
lysines in H3 and H4 histone t
ails; subunit of the Set3 comp
lex, a meiotic-specific repres
sor of sporulation specific ge
nes that contains deacetylase
activity; co-localizes with Cm
r1p in nuclear foci in respons
e to DNA damage by MMS

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_25228(Protein)
MWAFAIIQSPKPPEHIPEVPIAYHHGYNITACGIEKLHPFDSQKYGKVFHELNIQGQYIV
PSKCPRSLLIAVHPFWFLLSLCYSLQIFRAIEVPIFFLPAPVLRWRVLNPMLLATHGSII
AGCAAVTNRKFGINLSGGYHHASSTSCGGFCIYADITLTIYWIRRWYPEAVKKVLIVDLD
AHQGNGHERDFIKCPDTFILDFYNDEIYPGDFIAKEAIRYGDNFNFEHTDEFYLEKLEIA
LRHCIKVFRPDFILYNAGTDCMQGDPLGNLNISSSGIIKRDEIVFTHSIENHIPILMVLS
GGYQKQNAATIAKSIKNLNSKFNIYT


>SteCoe_25228(CDS)
ATGTGGGCTTTTGCAATAATACAAAGTCCTAAACCTCCAGAGCATATTCCAGAAGTTCCA
ATAGCTTATCATCATGGCTATAATATAACTGCATGTGGCATAGAAAAACTTCACCCATTT
GATTCGCAAAAATACGGTAAAGTATTTCACGAATTAAATATTCAAGGTCAGTATATTGTT
CCTAGTAAATGCCCAAGATCTTTATTAATTGCAGTGCATCCATTCTGGTTTCTTTTAAGT
CTTTGCTATTCACTTCAAATCTTTAGAGCTATAGAAGTCCCAATATTTTTCCTTCCAGCT
CCAGTACTACGTTGGCGAGTATTAAATCCTATGCTATTAGCGACTCATGGAAGTATTATT
GCTGGCTGTGCAGCAGTGACTAATAGAAAATTTGGAATCAATCTTTCAGGAGGTTATCAT
CATGCTAGTAGTACTTCATGTGGAGGGTTTTGCATTTATGCTGATATTACACTTACAATA
TATTGGATAAGGAGATGGTATCCAGAAGCTGTAAAAAAAGTGCTTATAGTTGATTTAGAT
GCTCATCAAGGAAATGGACATGAAAGGGATTTTATTAAATGTCCTGACACTTTTATTCTT
GATTTTTACAATGATGAAATTTACCCTGGAGACTTTATTGCAAAAGAAGCCATAAGATAT
GGAGATAACTTTAATTTCGAGCACACTGATGAATTTTACTTAGAAAAACTTGAAATAGCA
CTTCGTCACTGTATAAAAGTGTTTCGCCCAGATTTTATCTTGTATAATGCAGGGACTGAC
TGTATGCAAGGAGATCCTTTAGGAAATCTTAACATAAGCAGTTCAGGAATAATAAAGCGT
GATGAAATAGTATTTACTCATTCAATTGAAAATCACATACCTATTCTCATGGTACTTTCA
GGAGGCTATCAAAAGCAAAATGCCGCTACAATAGCAAAATCAATAAAAAATCTCAACTCA
AAGTTCAATATTTATACTTAG