Identifiers and Description

Gene Model Identifier

SteCoe_25318

Standard Name

None

Aliases

None

Description

DEAD_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000108392.7487850079102147e-43
Oxytricha TrifallaxContig5554.0.g995.5210822770285325e-42Helicase C-terminal domain

Tetrahymena ThermophilaTTHERM_006831801.5007857627073948e-41DNA repair helicase
Saccharomyces CerevisiaeYPL008W8.194012623990515e-40Probable DNA helicase; involve
d in sister-chromatid cohesion
and genome integrity and inte
rstrand cross-link repair; int
eracts with ECO1 and CTF18; mu
tants are defective in silenci
ng, rDNA recombination, aging
and the heat shock response; F
ANCJ-like helicase family memb
er; mutations in the human hom
olog, DDX11/ChLR1, cause Warsa
w breakage syndrome

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_25318(Protein)
MEREFDFPGEPYQVQLDFMNNLYTCLNSYKVGIFESPTGTGKSLSLICSSFKWLKANKNL
QKDDENFTGSQSWVNDIPTESSEVLNEITNLENLAQEKQTLNNLNDSVPLKIIYISRTHT
QLDQFANEIKKTIWNTDMKVVRLGSRSQFCVNPELAGFKSRGIIDFKCKELIDPDFPSTC
PYYKTHTSLTNHLLSNVCDIEDLVGYGKRYKACPYFGTRAAIPHADVILAPYTLILNERN
RESIGMDLINSVLIIDEAHNIIEAMADCHSSSITKVHVQNSLQATLSYYERFGNKIGARS
LMFFDQIIKVLRSIQVFISNHCVNKKSSSISIGDYLLETDLERVDLYKIIMFIEEIEFGR
KVVAYAEKAGIKGSMNSVPVFIEFLRALCGDASSGKILTNLNDEEGIRYLLVNPNKKFQE
LVEKTRCLILAGGTMEPKSEYLDLFSNISNDKIKVFTCGHVINQENLLLGVVGRGDSGCE
LRFTFDNRDNSRIFNDLGELLRKVCEIVPNGVVVFLPSYFFLSKLKVYMEKNGILAKIMR
KKSVHFDNKDENILDEYSRNAVSSGALLFAVVRGRLSEGINFSDKLGRCVVMVGLPYLNK
TDVEIQEKMKFLDASGKNFTGRMFYESSCHKAINQSIGRAIRHKNDYAVVLLVDERHSNS
INRRPEWMVKNIIPKSVSVYEAISTFFKNK


>SteCoe_25318(CDS)
ATGGAGCGGGAATTTGATTTTCCAGGTGAGCCATACCAAGTCCAACTCGACTTCATGAAC
AATCTCTACACCTGTTTAAACTCTTATAAAGTAGGGATATTCGAAAGCCCAACAGGCACA
GGGAAATCATTAAGCCTCATATGCAGTTCATTCAAATGGCTTAAAGCTAACAAAAACTTA
CAAAAAGATGATGAAAATTTTACTGGCAGCCAATCTTGGGTAAATGATATCCCTACAGAA
AGTTCAGAAGTCTTAAACGAAATCACAAACCTTGAAAACTTAGCTCAAGAAAAACAAACT
TTAAATAACCTAAATGATTCAGTCCCTTTAAAAATTATCTACATCAGTAGAACACATACC
CAATTAGATCAATTTGCAAATGAAATAAAAAAAACTATATGGAATACTGATATGAAAGTT
GTAAGATTAGGGTCAAGATCCCAGTTTTGTGTAAACCCAGAACTTGCCGGGTTTAAATCT
AGAGGGATAATCGATTTCAAATGTAAAGAGTTAATCGATCCTGATTTCCCAAGTACATGT
CCGTATTATAAAACCCATACTTCATTGACGAATCATCTTTTAAGCAATGTTTGTGATATT
GAAGATTTAGTTGGATATGGGAAAAGATATAAAGCTTGTCCTTATTTTGGCACTAGGGCT
GCAATACCTCATGCTGATGTGATTTTAGCCCCTTATACACTGATACTAAATGAACGTAAT
AGAGAAAGTATTGGTATGGATTTAATAAACTCAGTTCTTATAATAGATGAAGCACATAAT
ATAATAGAAGCTATGGCTGATTGTCATTCTTCTAGTATAACAAAAGTCCATGTGCAAAAT
TCCTTACAAGCAACTTTAAGTTATTATGAAAGATTTGGTAATAAAATAGGGGCAAGGTCT
CTAATGTTTTTTGACCAAATAATCAAAGTACTTAGATCTATACAAGTTTTTATATCAAAT
CATTGTGTAAATAAAAAATCATCATCAATATCAATAGGGGATTATTTACTAGAAACTGAT
CTTGAACGTGTGGATTTGTATAAAATTATTATGTTTATAGAAGAAATTGAGTTCGGGAGA
AAAGTTGTCGCATATGCAGAAAAAGCTGGGATTAAAGGGAGTATGAACAGTGTGCCTGTT
TTTATAGAGTTTTTACGAGCATTATGTGGAGATGCGTCATCAGGTAAAATCCTCACAAAC
TTAAATGATGAAGAAGGGATAAGATATTTGCTTGTAAATCCTAATAAAAAATTCCAAGAA
CTTGTCGAAAAAACCAGATGTCTTATTTTAGCAGGTGGGACAATGGAGCCAAAAAGTGAA
TATTTAGATCTTTTTAGCAACATTAGCAATGATAAAATCAAAGTTTTCACATGCGGCCAT
GTTATTAATCAAGAAAACTTACTTTTAGGGGTTGTTGGTAGAGGAGATAGTGGTTGTGAG
CTGAGGTTTACTTTTGATAATAGAGACAATTCTAGGATTTTCAATGATTTAGGCGAGTTA
CTTAGGAAAGTATGTGAAATTGTCCCAAATGGAGTTGTTGTGTTTTTACCATCGTATTTT
TTTCTATCAAAACTTAAGGTTTATATGGAAAAAAATGGAATACTGGCTAAAATCATGAGG
AAAAAAAGTGTGCATTTTGATAATAAGGATGAGAATATACTTGATGAATATTCGAGAAAT
GCTGTTTCATCAGGAGCTTTATTGTTTGCCGTGGTTCGTGGAAGACTTAGTGAAGGGATT
AATTTTTCTGATAAACTGGGCAGGTGTGTTGTTATGGTTGGACTGCCTTATCTTAATAAA
ACTGATGTGGAAATACAGGAGAAAATGAAGTTTTTGGATGCGAGTGGGAAAAATTTTACA
GGAAGGATGTTTTATGAAAGCAGCTGCCATAAAGCTATTAACCAATCTATTGGAAGAGCT
ATTCGACATAAAAACGATTATGCTGTGGTCCTTTTGGTAGACGAAAGGCATAGCAATTCT
ATCAATCGTCGTCCGGAGTGGATGGTTAAAAACATTATACCAAAATCGGTTTCTGTCTAT
GAAGCAATTTCAACTTTTTTCAAAAACAAATAA