Identifiers and Description

Gene Model Identifier

SteCoe_25327

Standard Name

None

Aliases

None

Description

Not3 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_001610700.000000000000001713908431542013NOT2 / NOT3 / NOT5 family prot
ein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_25327(Protein)
MIASKIDPSEEQREMIKSLQRSFYDKISTREADLEKAKSQKFKPGTYDEITKHIKNLRSH
YEKLEHLLRFIENNPVTLEQLWPLTDKLQNYLKTDDTEDLEAELEQKYKDFNLPISKIMS
NFPALNEEDQEVKKVLGKKLETKQMPSVVIKSESKPVEKGWNTKEALMKIAGKVEKVVED
IQDDEEEPEKIDLDWSKKQIDFAFNYPIRNDESAKSSLQMVLTPYPGHPSYPKKPMINPG
LFSKFDLDTLFFIFYHQHGTYQQFLAAKELKAQGWIYHKKFQTWFQRSGEPKLTAQDREK
GTFLYFDYETSWSQRRKADFEFEYSFLENDLL


>SteCoe_25327(CDS)
ATGATTGCATCTAAAATCGACCCATCTGAAGAACAGCGTGAAATGATAAAATCCCTTCAA
AGATCCTTTTATGACAAAATCAGCACACGCGAGGCTGATCTAGAAAAAGCTAAAAGCCAA
AAATTCAAACCAGGGACATATGATGAGATTACAAAACACATAAAAAACCTTCGTAGCCAT
TATGAAAAACTAGAGCATTTACTAAGATTTATAGAAAACAATCCAGTTACATTAGAACAG
CTCTGGCCATTGACTGACAAATTACAAAATTATTTGAAAACAGATGACACAGAGGATTTA
GAAGCTGAATTAGAACAAAAATATAAAGATTTCAACTTGCCGATAAGTAAAATTATGTCA
AATTTCCCAGCTTTAAATGAAGAAGATCAAGAAGTGAAGAAAGTATTAGGAAAAAAGCTT
GAAACCAAGCAAATGCCGAGTGTGGTAATAAAATCTGAATCAAAACCTGTGGAGAAAGGG
TGGAACACAAAAGAGGCGCTGATGAAAATTGCAGGAAAAGTTGAAAAAGTGGTGGAAGAC
ATTCAGGATGACGAGGAGGAGCCAGAAAAAATCGACTTGGATTGGTCGAAAAAACAGATT
GACTTTGCTTTTAATTACCCAATACGTAATGATGAAAGTGCTAAGTCTAGCTTGCAGATG
GTCCTTACGCCATACCCAGGCCATCCTTCCTACCCAAAAAAACCTATGATAAACCCTGGG
TTATTCAGTAAATTCGACCTAGACACGCTTTTTTTCATATTTTACCATCAACATGGGACT
TATCAACAGTTCCTAGCAGCTAAAGAACTCAAAGCCCAAGGGTGGATTTATCACAAGAAG
TTCCAGACCTGGTTCCAACGTTCTGGTGAGCCAAAACTCACTGCTCAAGACCGTGAAAAA
GGCACATTCCTTTATTTTGATTATGAAACCAGCTGGTCACAACGTAGAAAAGCTGACTTC
GAATTCGAGTACTCGTTTCTTGAAAATGACTTGCTTTAA